DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Gucy2g

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:250 Identity:79/250 - (31%)
Similarity:122/250 - (48%) Gaps:54/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   831 LLTNILPSHVVEVYLDSVANHELYYENYKMVSVMFAMLINF------QMDLPSLRVLNDIITEFD 889
            ||:.:|||.|.|   ..:|...:..|:::.|::.|:.::.|      ...|..:::|||:.:.||
Mouse   873 LLSTMLPSFVGE---QLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFD 934

  Fly   890 RLLNAYKEYYVVEKIKVVGCTYMAACGLDFTLAKSKFGSRTHASYSSELEQVLYRKESKGTENDH 954
            ..:.::..|    |::.:|..||.|.||..         |..|.::                   
Mouse   935 HTIQSHDVY----KVETIGDAYMVASGLPI---------RNGAQHA------------------- 967

  Fly   955 DEVAFIMTTFALDLMRVLSVCNKAYAGR-PFDRALSTGEICIGISTGEIMAGVVGASQPHYDIWG 1018
            ||:|    |.||.|   |||......|. |.:|.    ::.||:.||.::|||||.:.|.|.::|
Mouse   968 DEIA----TMALHL---LSVTTHFQIGHMPEERL----KLRIGLHTGPVVAGVVGITMPRYCLFG 1021

  Fly  1019 NPVNMASRMESTGLPGHIHVTQETAN-ILEQFDIMCMYRGMTFVKGRGEIPTYFV 1072
            :.|||||||||:.||..|||:|.||. :|.........||...|||:||..|:::
Mouse  1022 DTVNMASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVKGKGEQTTFWL 1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 70/223 (31%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 71/226 (31%)
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894
CYCc 865..1055 CDD:214485 71/227 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.