DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and npr3

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:246 Identity:50/246 - (20%)
Similarity:73/246 - (29%) Gaps:101/246 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   952 NDHDEVAFIM---TTFALDLMRVLSVCN---------KAYAGRPF------------------DR 986
            ||:.||..::   .|:.....||.....         .||||..|                  ||
Zfish    25 NDNIEVMVMLPRNNTYLFSYTRVFPAIEYAKKALREADAYAGLRFNVRFENSACGMDALYALVDR 89

  Fly   987 A------LSTGEICIGISTGEIMAGVVGASQPHYDIWGNPVNMASRMESTGL----PGHIHVTQE 1041
            .      |..|.:|      |..|..|.....|   |..||..|..: :||.    |.:.|:|:.
Zfish    90 QKDERPDLVLGPVC------EYAASSVTRVASH---WNIPVISAGAL-ATGFNSKTPEYSHLTRI 144

  Fly  1042 TANILEQFDIMCMYRGMTF--VKGR-GEIPTYFVGIDD----NLKFLPSNV----KKNNMSKRFS 1095
            ....|:..:        ||  :.|. |....|.:..||    |..|....|    .:.::|..|:
Zfish   145 APTYLKMAE--------TFQAIFGHFGWRTAYLIYDDDKDERNCYFTMEGVFTVLSEYHISTDFA 201

  Fly  1096 ILSS--------------------------------LVPVHSRSTTSSEYI 1114
            :|:|                                ::..|.|..||..:|
Zfish   202 VLNSNEERVDPDGIITSVYGSEVVIMCSKADIVRDLMLAAHRRKLTSDSHI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 30/134 (22%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 36/162 (22%)
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 48/242 (20%)
ANF_receptor 46..389 CDD:279440 45/225 (20%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.