DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and npr1a

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001038402.1 Gene:npr1a / 560653 ZFINID:ZDB-GENE-060503-539 Length:1067 Species:Danio rerio


Alignment Length:315 Identity:89/315 - (28%)
Similarity:147/315 - (46%) Gaps:47/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LKSDDEDISEVVHDLDTICVDIFHYLGFNLMGIFFRIMNDTMVR-SSFLDRHQFLKEEMWLRQAR 250
            |:...||::| ..|...|.|    .|..|..|....|:::.:.| ..:.:..:.|.||.  .||.
Zfish   788 LRCWSEDVNE-RPDFSQIKV----LLRKNNCGYGSNILDNLLSRMEQYANNLEELVEER--TQAY 845

  Fly   251 QQE----SMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENFMAIQIHPDVSILYA 311
            .:|    ..||..|||..:|:.:::.  |.:.....||                     |:|.::
Zfish   846 HEEKRKAEALLYQILPHSVAEQLKRG--EMVQAEAFDS---------------------VTIYFS 887

  Fly   312 DVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVAGL----GEADPDHA 372
            |:|.:|.|:...|..::|.:|:|||..||.....|.|.:::.:||.|..|:||    |:.   ||
Zfish   888 DIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKL---HA 949

  Fly   373 RMAVSLGISMIANIQEVR-AHRA-LDIDMRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEA 435
            |....:.::::..:...| .||. |.:.:|||:|||.:.|||:|....:|.::|..|:.|:|:|:
Zfish   950 REIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMES 1014

  Fly   436 TGKPGYVHVSGRTLSSLNVAEYTVFPGTEVAQSDPILQKQPMTTYLLTAAPSRNS 490
            .|:...:|||..|.:.|.  |:..|. .|:.....:..|..|.||.|....|.|:
Zfish  1015 NGEALKIHVSEATRAVLQ--EFNCFQ-LELRGDVEMKGKGRMRTYWLLGEISSNN 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 24/93 (26%)
CYCc 249..459 CDD:214485 64/219 (29%)
Nucleotidyl_cyc_III 298..484 CDD:299850 60/191 (31%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
npr1aNP_001038402.1 PBP1_NPR_A 48..449 CDD:107380
ANF_receptor 66..421 CDD:279440
PK_GC-A_B 540..814 CDD:270944 9/30 (30%)
TyrKc 554..808 CDD:197581 7/24 (29%)
HNOBA <823..868 CDD:285003 13/46 (28%)
CYCc 847..1032 CDD:214485 61/210 (29%)
Guanylate_cyc 874..1060 CDD:278633 62/212 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.