DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Gucy1b1

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_059497.1 Gene:Gucy1b1 / 54195 MGIID:1860604 Length:620 Species:Mus musculus


Alignment Length:419 Identity:101/419 - (24%)
Similarity:164/419 - (39%) Gaps:125/419 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LVDIFQILVFH--FKYHWPLNTLYDVFVL------------------------C------MIY-- 157
            |:.:|.::..|  ..:|..|:.:..||||                        |      |||  
Mouse   250 LLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEISCLRLKGQMIYLP 314

  Fly   158 -----MFLPIPSIRGAALLATSVSLMYIGLFIYFLKSDDEDISEVVHDLDTICVDIFHYLGFNLM 217
                 :||..||:....      .|...||::     .|..:.:...||             .|:
Mouse   315 EADSILFLCSPSVMNLD------DLTRRGLYL-----SDIPLHDATRDL-------------VLL 355

  Fly   218 GIFFR-IMNDTMVRSSFLDRHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSE 281
            |..|| ....|.......||.|.....  |...:::...||.|:|||.:|..::.          
Mouse   356 GEQFREEYKLTQELEILTDRLQLTLRA--LEDEKKKTDTLLYSVLPPSVANELRH---------- 408

  Fly   282 TDSDRIVVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTLT----VEKLVKVLHDLYGRFDMA 342
                :..|.|:|.:|         |:||::.:|.:....:...    ..|:|.:|:|||.|||..
Mouse   409 ----KRPVPAKRYDN---------VTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTL 460

  Fly   343 ASTFK---VQRIKFLGDCYYCVAGLGEADPDHARMAVSLGISMIANIQEVRAHRALD---IDMRI 401
            ..:.|   |.:::.:||.|..|:||.|....|||....|.:.|:    |:.....:|   :.:.|
Mouse   461 TDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMM----EIAGQVQVDGESVQITI 521

  Fly   402 GVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEVA 466
            |:|:|.::.|||||...:|.::|..|::.:|.|.||:.|          .:||:|||........
Mouse   522 GIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG----------KINVSEYTYRCLMSPE 576

  Fly   467 QSDPIL------------QKQPMTTYLLT 483
            .|||:.            :|:||..:.|:
Mouse   577 NSDPLFHLEHRGPVSMKGKKEPMQVWFLS 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 39/188 (21%)
CYCc 249..459 CDD:214485 61/219 (28%)
Nucleotidyl_cyc_III 298..484 CDD:299850 58/208 (28%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Gucy1b1NP_059497.1 HNOB 2..166 CDD:311572
HNOBA 207..406 CDD:311573 39/181 (22%)
Guanylate_cyc 412..605 CDD:306677 61/215 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.