DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and NPR2

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:270 Identity:80/270 - (29%)
Similarity:141/270 - (52%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 IMNDTMVR-SSFLDRHQFLKEE---MWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETD 283
            |:::.::| ..:.:..:.|.||   .:|.:.|:.|: ||..|||..:|:.:::.  |.:.....|
Human   853 ILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEA-LLYQILPHSVAEQLKRG--ETVQAEAFD 914

  Fly   284 SDRIVVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKV 348
            |                     |:|.::|:|.:|.|:...|..::|.:|:|||..||.....|.|
Human   915 S---------------------VTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDV 958

  Fly   349 QRIKFLGDCYYCVAGL----GEAD-PDHARMAVSLGISMIANIQEVRAHRALD-IDMRIGVHSGT 407
            .:::.:||.|..|:||    |:.. |:.||||::| :..:::.: :| ||..| :.:|||||:|.
Human   959 YKVETIGDAYMVVSGLPGRNGQRHAPEIARMALAL-LDAVSSFR-IR-HRPHDQLRLRIGVHTGP 1020

  Fly   408 LLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEVAQSDPIL 472
            :.|||:|....:|.::|..|:.|:|:|:.|:...:|||..|..:|:  |...|. .|:.....:.
Human  1021 VCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALD--ELGCFQ-LELRGDVEMK 1082

  Fly   473 QKQPMTTYLL 482
            .|..|.||.|
Human  1083 GKGKMRTYWL 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 14/56 (25%)
CYCc 249..459 CDD:214485 67/215 (31%)
Nucleotidyl_cyc_III 298..484 CDD:299850 63/191 (33%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944
HNOBA <857..902 CDD:311573 13/45 (29%)
CYCc 881..1065 CDD:214485 65/210 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.