DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and NPR1

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_000897.3 Gene:NPR1 / 4881 HGNCID:7943 Length:1061 Species:Homo sapiens


Alignment Length:295 Identity:76/295 - (25%)
Similarity:137/295 - (46%) Gaps:58/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 IFHYLGFNL--MGIFFRI-------MNDTMVRSSFLDRHQFLKEEMW----------------LR 247
            :||..|.:|  ..|..|:       ...::...|.|:....|.:..|                ||
Human   738 VFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLR 802

  Fly   248 Q-ARQQESMLLDSILP--PQIAKPIQQSIKER------------IMLSETDSDRIVVNARRTENF 297
            : .|:..|.:||::|.  .|.|..:::.::||            .:|.:.....:....:|.|..
Human   803 KFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETV 867

  Fly   298 MAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVA 362
            .| :....|:|.::|:|.:|.|:...|..::|.:|:|||..||.....|.|.:::.:||.|..|:
Human   868 QA-EAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVS 931

  Fly   363 GLGEADP-----DHARMAVSLGISMIANIQEVRA----HRALD-IDMRIGVHSGTLLAGVIGQAK 417
            ||...:.     :.||||::|       :..||:    ||..: :.:|||:|:|.:.|||:|...
Human   932 GLPVRNGRLHACEVARMALAL-------LDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKM 989

  Fly   418 LQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSL 452
            .:|.::|..|:.|:|:|:.|:...:|:|..|.:.|
Human   990 PRYCLFGDTVNTASRMESNGEALKIHLSSETKAVL 1024

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 19/95 (20%)
CYCc 249..459 CDD:214485 64/228 (28%)
Nucleotidyl_cyc_III 298..484 CDD:299850 52/165 (32%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
NPR1NP_000897.3 PBP1_NPR_A 36..443 CDD:107380
ANF_receptor 54..414 CDD:279440
PK_GC-A_B 534..807 CDD:270944 12/68 (18%)
TyrKc 547..801 CDD:197581 10/62 (16%)
HNOBA <816..861 CDD:285003 6/44 (14%)
CYCc 840..1032 CDD:214485 55/193 (28%)
Guanylate_cyc 867..1053 CDD:278633 52/166 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.