DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Gycbeta100B

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster


Alignment Length:528 Identity:116/528 - (21%)
Similarity:185/528 - (35%) Gaps:192/528 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 QIVNDKFTICVECIVIDMVVF--TFLTSLLFISWFKKVCWWRCVENDSRKYGRVSCKLFKIWERI 662
            ::.:|...:| |..:|....|  .|...|:|....|.|...:.|.....:....:|.|.::.|.|
  Fly   314 EVPDDMEFLC-EAPLISPATFCKVFPFHLMFDRQMKIVQAGKAVSRVIPRVAEENCSLIEVVEAI 377

  Fly   663 QHSFVLRVTIYMSIVASYYLL---------------------------ISTILLNCDKNQYELDV 700
            :....|.....:|.:.:.|:|                           ...||..|..:...||.
  Fly   378 RPHLQLNFENILSHINTIYVLQTRQGAMSSRHEQRFLRLKGQMMYIPETDRILFQCYPSVMNLDD 442

  Fly   701 INSK-LYHYDIVTDNCFNPWVFTDMISLIVGVSYTFARIPFALKMLITCCATVAYLVIVFFQYSF 764
            :..| ||..|:...:                                      |...:|.....|
  Fly   443 LTKKGLYISDVPLHD--------------------------------------AARDLVLLSEKF 469

  Fly   765 IFEHSATTTPFMKAELAHCLRVCMMLLTMYAKERQSEFNTKINFKINQDLQGKQKAADITNKSII 829
            ..|:..|..                 |.|...:.|..|         :||:.:::..|       
  Fly   470 EAEYKLTKN-----------------LEMLTDKLQQTF---------RDLESEKQKTD------- 501

  Fly   830 ILLTNILPSHVVEVYLDSVANHELYYE------NYKMVSVMFAMLINFQM----------DLPSL 878
            .||.::||.        |||| ||.::      .|..|::||:.::.|..          .:..:
  Fly   502 RLLYSVLPK--------SVAN-ELRHQRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIV 557

  Fly   879 RVLNDIITEFDRLLNAYKEYYVVEKIKVVGCTYMAACGLDFTLAKSKFGSRTHASYSSELEQVLY 943
            ::||::.|.||.|.:: |....|.|::.||..|||..||.                         
  Fly   558 KMLNELYTVFDALTDS-KRNLNVYKVETVGDKYMAVSGLP------------------------- 596

  Fly   944 RKESKGTENDH-DEVAFIMTTFALDLMRVLSVCNKAYAGRPFDRALSTGEICIGISTGEIMAGVV 1007
                     || ::.|..|...|||:|.:..  |......|.       :|.|||.:||::.||:
  Fly   597 ---------DHCEDHAKCMARVALDMMDMAK--NVKMGSNPV-------QITIGIHSGEVVTGVI 643

  Fly  1008 GASQPHYDIWGNPVNMASRMESTGLPGHIHVTQETANILEQFDIMCM-----------YRGMTFV 1061
            |...|.|.::||.||:.||.|:||:||.|:|::||      :.::||           |||...:
  Fly   644 GNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEET------YRLLCMAINQDDSFHLEYRGPVIM 702

  Fly  1062 KGRGEIPT 1069
            ||:   ||
  Fly   703 KGK---PT 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 67/238 (28%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 67/245 (27%)
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 45/269 (17%)
CYCc 496..688 CDD:214485 70/257 (27%)
Guanylate_cyc 522..714 CDD:278633 66/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.