DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Gyc89Da

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:328 Identity:79/328 - (24%)
Similarity:145/328 - (44%) Gaps:66/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 IYFLKSDDEDI---SEVVHDLDTICVDIFHYLGFNLMGIFFRIMNDTMVRSSFLDRH------QF 239
            ::::|..|..|   |.::.:||.:     |.:|..|..:....::..:|.:.:  :|      .|
  Fly   379 MFYIKDVDSLIFLCSPLIENLDEL-----HGIGLYLNDLNPHGLSRELVMAGW--QHCSKLEIMF 436

  Fly   240 LKEEM--------------WLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVN 290
            .|||.              |.||..:    ||.|::|..||        ||:.|||.        
  Fly   437 EKEEQRSDELEKSLELADSWKRQGDE----LLYSMIPRPIA--------ERMRLSEE-------- 481

  Fly   291 ARRTENFMAIQIHPDVSILYADVVN-YTH-LTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKF 353
                   ...|...:||:::.:|:| |.. |.:.....:.|..|:.::...|....:..|.:::.
  Fly   482 -------QVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPFVYKVET 539

  Fly   354 LGDCYYCVAGLGEADPDHARMAVSLGISMIANIQEVRAHRALDIDMRIGVHSGTLLAGVIGQAKL 418
            :|..|..|:|..:.:|.||..|..|.:.:   :::.:||...|:.:|:|::||.::|||:||...
  Fly   540 VGMVYMAVSGAPDVNPLHAEHACDLALRV---MKKFKAHDMGDVAIRVGINSGPVVAGVVGQKVP 601

  Fly   419 QYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEVAQSDPILQKQPMTTYLLT 483
            :|.::|..|:.|:|:|::..|..:.:|..|...:....|.|    |...:..:..|..|.||.|.
  Fly   602 RYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKV----ESRGTVQVKGKGDMETYWLL 662

  Fly   484 AAP 486
            ..|
  Fly   663 EGP 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 24/114 (21%)
CYCc 249..459 CDD:214485 53/211 (25%)
Nucleotidyl_cyc_III 298..484 CDD:299850 49/187 (26%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 25/115 (22%)
CYCc 457..643 CDD:214485 56/219 (26%)
Guanylate_cyc 485..662 CDD:278633 48/183 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.