DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Gyc88E

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster


Alignment Length:501 Identity:110/501 - (21%)
Similarity:198/501 - (39%) Gaps:152/501 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 MVFSSILSAYIVVLVDI--------FQIL--VFHFKYHWPLNTLYDVFVLC-------------- 154
            ||..||.::.:|:|.::        |.::  :..||:...||...::|.|.              
  Fly   222 MVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNE 286

  Fly   155 --------------------MIY-------MFLPIPSIRGAALLATSVSLMYIGLFIYFLKSDDE 192
                                |:|       |||      |..::....||:..||:|       .
  Fly   287 DLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFL------GTPVMPDLTSLITTGLYI-------N 338

  Fly   193 DISEVVHDLDTICVDIFHYLGFNLMGIFFRI-MNDTMVRSSFLDRH-QFLKEEMWLRQARQQESM 255
            |:|  :||...   |:.  |......:..:: ::....:|..|:.. :.|.|||      ::...
  Fly   339 DLS--MHDFSR---DLM--LAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEM------RRTDE 390

  Fly   256 LLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTEN-FMAIQIHPDVSILYADVVNYTHL 319
            ||..::|.|:|                  ||:    ||.|| ....::...||||::|:|.:|.:
  Fly   391 LLYQMIPKQVA------------------DRL----RRGENPIDTCEMFDSVSILFSDIVTFTEI 433

  Fly   320 TTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVAGLGEADPDHARMAVSLGISMIA 384
            .:.:|..::|.:|:.:|..||.......|.:::.:||.|..|||..:.|.:||.....:.:.|:.
  Fly   434 CSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVD 498

  Fly   385 NIQEVR-AHRALDIDMRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRT 448
            .|.::: ......:.:|:|||||.::||::|....:|.::|..|:.|:|:|:|.....||:|..|
  Fly   499 AITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST 563

  Fly   449 ----------------------------------------LSSLNVAEYTVFPGTEVAQ------ 467
                                                    .::|.|...:..|.|...:      
  Fly   564 KVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLPLQLTAALQVHPLSPVPPTPTPKTKAIMP 628

  Fly   468 --SDPILQKQPMTTYLLTAAPSRNSVRSVDAVHSYAEIDINALGAS 511
              |.|:....|::..|..:.|:.| |.:||.:.|.:.|...||.|:
  Fly   629 PVSKPLTPMMPVSVSLAASMPTSN-VPAVDVMASSSSISGLALTAA 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 41/214 (19%)
CYCc 249..459 CDD:214485 58/251 (23%)
Nucleotidyl_cyc_III 298..484 CDD:299850 53/234 (23%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 42/225 (19%)
CYCc 383..571 CDD:214485 59/215 (27%)
Herpes_ICP4_C 794..>955 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.