DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and GUCY2D

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_000171.1 Gene:GUCY2D / 3000 HGNCID:4689 Length:1103 Species:Homo sapiens


Alignment Length:300 Identity:83/300 - (27%)
Similarity:128/300 - (42%) Gaps:79/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 MMLLTMYA-------KERQSEFNTKINFKINQDLQGKQKAADITNKSIIILLTNILPSHVVEVYL 845
            :.:|..|:       :||..|...:           |||    |::    |||.:||..|.|...
Human   821 LRMLEQYSSNLEDLIRERTEELELE-----------KQK----TDR----LLTQMLPPSVAEALK 866

  Fly   846 DSVANHELYYENYKMVSVMFAMLINF----QMDLP--SLRVLNDIITEFDRLLNAYKEYYVVEKI 904
            ........|:|   .|::.|:.::.|    .|..|  .:.:|||:.|.||.::.::..|    |:
Human   867 TGTPVEPEYFE---QVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVY----KV 924

  Fly   905 KVVGCTYMAACGLDFTLAKSKFGSRTHASYSSELEQVLYRKESKGTENDHDEVAFIMTTFALDLM 969
            :.:|..||.|.||     ..:.|.| ||:..:.:..               ::...:.||.:..|
Human   925 ETIGDAYMVASGL-----PQRNGQR-HAAEIANMSL---------------DILSAVGTFRMRHM 968

  Fly   970 RVLSVCNKAYAGRPFDRALSTGEICIGISTGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPG 1034
            ..:.|                 .|.||:.:|..:|||||.:.|.|.::|:.||.||||||||||.
Human   969 PEVPV-----------------RIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY 1016

  Fly  1035 HIHVTQETANILEQFD--IMCMYRGMTFVKGRGEIPTYFV 1072
            .|||...|..||...|  .....||.|.:||:|...|:::
Human  1017 RIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWL 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 65/227 (29%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 67/226 (30%)
GUCY2DNP_000171.1 PBP1_sensory_GC_DEF-like 55..431 CDD:380594
PK_GC-2D 536..811 CDD:270945
HNOBA <820..865 CDD:369471 16/62 (26%)
CYCc 846..1036 CDD:214485 71/242 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1065..1103
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.