DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and GUCY1B1

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:442 Identity:104/442 - (23%)
Similarity:179/442 - (40%) Gaps:128/442 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LVDIFQILVFH--FKYHWPLNTLYDVFVLCMIYMFLPIPSIR-GAALLATSVSLMYI-GLFIYFL 187
            |:.:|.::..|  ..:|..|:.:..||||......|.:..:. ...|..|.:|.:.: |..||..
Human   250 LLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLP 314

  Fly   188 KSDD------------ED-------ISEV-VHDLDTICVDIFHYLGFNLMGIFFR---------- 222
            ::|.            :|       :|:: :||.....|         |:|..||          
Human   315 EADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLV---------LLGEQFREEYKLTQELE 370

  Fly   223 IMNDTMVRSSFLDRHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKER--IMLSETDS- 284
            |:.|.:              ::.|| |.:.|....|:..|.:|     |:.|.:  :||.|.|| 
Human   371 ILTDRL--------------QLTLR-ALEDEKKKTDTGCPARI-----QAFKVQTTLMLCEKDSR 415

  Fly   285 ------------------DRI--------VVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTL 323
                              :|:        |.|..|.:..:..:.:.:|:||::.:|.:....:..
Human   416 STKGFPSISYSGFLLIPLNRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKH 480

  Fly   324 T----VEKLVKVLHDLYGRFDMAASTFK---VQRIKFLGDCYYCVAGLGEADPDHARMAVSLGIS 381
            .    ..|:|.:|:|||.|||....:.|   |.:::.:||.|..|:||.|....|||....|.:.
Human   481 ASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALD 545

  Fly   382 MIANIQEVRAHRALD---IDMRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVH 443
            |:    |:.....:|   :.:.||:|:|.::.|||||...:|.::|..|::.:|.|.||:.|   
Human   546 MM----EIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG--- 603

  Fly   444 VSGRTLSSLNVAEYTVFPGTEVAQSDPIL------------QKQPMTTYLLT 483
                   .:||:|||.........|||..            :|:||..:.|:
Human   604 -------KINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLS 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 37/182 (20%)
CYCc 249..459 CDD:214485 66/248 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 58/208 (28%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 45/227 (20%)
Guanylate_cyc 455..648 CDD:306677 57/206 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.