DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and GUCY1A2

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:349 Identity:85/349 - (24%)
Similarity:146/349 - (41%) Gaps:95/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LDR-HQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENF 297
            |:| ||.|:||      :::...||.||.|..:|:.:.|..:              |.||:.:  
Human   476 LERTHQALEEE------KKKTVDLLYSIFPGDVAQQLWQGQQ--------------VQARKFD-- 518

  Fly   298 MAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVA 362
                   ||::|::|:|.:|.:....|..:::.:|::||.|||.......:.:::.:||.|...|
Human   519 -------DVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAA 576

  Fly   363 GLGEADPDHARMAVSLGISMI--------------------------ANIQEVRAHRALDID--- 398
            ||......||:....:.:.|:                          .:||.|......:.|   
Human   577 GLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSETDLGT 641

  Fly   399 --MRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAE-YTVF 460
              ||||:|||::||||:|....:|.::|.:|.:|::.|:...|..::||..|...|...| :|..
Human   642 EKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFI 706

  Fly   461 PGTEVAQSDPILQKQPMTTYLLTAAPSRNSVRSVDAVHSYAEIDINALGASRKSPILRPTLMSDE 525
            |.:.....|...::.|...|.|       .||:                 ..|.|  :|:|.|..
Human   707 PRSREELPDNFPKEIPGICYFL-------EVRT-----------------GPKPP--KPSLSSSR 745

  Fly   526 LREEFKKMPVGGFNIRSPCCRDNS 549
            :    ||:   .:||.:...|:.|
Human   746 I----KKV---SYNIGTMFLRETS 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 14/42 (33%)
CYCc 249..459 CDD:214485 59/241 (24%)
Nucleotidyl_cyc_III 298..484 CDD:299850 55/217 (25%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003 12/32 (38%)
CYCc 485..705 CDD:214485 61/248 (25%)
Guanylate_cyc 514..729 CDD:278633 57/230 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.