DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Npr1

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_036745.1 Gene:Npr1 / 24603 RGDID:3195 Length:1057 Species:Rattus norvegicus


Alignment Length:252 Identity:68/252 - (26%)
Similarity:129/252 - (51%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 DRHQFLKEEMWLRQ-ARQQESMLLDSILP--PQIAKPIQQSIKER------------IMLSETDS 284
            :|..|.:..:.||: .::..|.:||::|.  .|.|..:::.::||            .:|.:...
  Rat   786 ERPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILP 850

  Fly   285 DRIVVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQ 349
            ..:....:|.|...| :....|:|.::|:|.:|.|:...|..::|.:|:|||..||.....|.|.
  Rat   851 HSVAEQLKRGETVQA-EAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVY 914

  Fly   350 RIKFLGDCYYCVAGL----GEADPDHARMAVSLGISMIANIQEVR-AHRALD-IDMRIGVHSGTL 408
            :::.:||.|..|:||    |:.   |||....:.::::..::..| .||..: :.:|||:|:|.:
  Rat   915 KVETIGDAYMVVSGLPVRNGQL---HAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPV 976

  Fly   409 LAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEV 465
            .|||:|....:|.::|..|:.|:|:|:.|:...:|:|..|.:.|.     .|.|.|:
  Rat   977 CAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLE-----EFDGFEL 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 10/43 (23%)
CYCc 249..459 CDD:214485 61/229 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 53/174 (30%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Npr1NP_036745.1 PBP1_NPR_A 32..439 CDD:107380
ANF_receptor 50..410 CDD:279440
PK_GC-A_B 530..803 CDD:270944 4/16 (25%)
TyrKc 543..797 CDD:197581 2/10 (20%)
HNOBA <812..857 CDD:285003 6/44 (14%)
CYCc 836..1025 CDD:214485 54/197 (27%)
Guanylate_cyc 863..1049 CDD:278633 53/175 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.