DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and PHLPP1

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_919431.2 Gene:PHLPP1 / 23239 HGNCID:20610 Length:1717 Species:Homo sapiens


Alignment Length:315 Identity:68/315 - (21%)
Similarity:110/315 - (34%) Gaps:83/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIV-VNARRTENFMAIQIHPDVSILYADVVN 315
            |.:.||:  |||.             :|.:.||.|.: .:|.:.|:.....:..:.:    .::.
Human   970 QHNQLLE--LPPN-------------LLMKADSLRFLNASANKLESLPPATLSEETN----SILQ 1015

  Fly   316 YTHLTTTLTVEKLV---------KVLHDLYGRF-----DMAASTFKVQRIKFLGDCYYCVAGLGE 366
            ..:||.....:|.|         |:||..|.|.     ...|...:::.|...|:..       :
Human  1016 ELYLTNNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKL-------K 1073

  Fly   367 ADPD--------HARMAVSLGISMIANIQEVRAHRALDIDMRIGVHSGTLLAGVIGQAKLQYDIW 423
            |.|.        |..:|.|..|.:...:.::...:.:|:... .:...||...:  ..|||    
Human  1074 AIPTTIMNCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCN-ELSEVTLPENL--PPKLQ---- 1131

  Fly   424 GPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVF----PGTEVAQSDPILQKQPMT------ 478
                    .|:.||.|..| :..:||..||  ....|    |.|..|...|.:.....|      
Human  1132 --------ELDLTGNPRLV-LDHKTLELLN--NIRCFKIDQPSTGDASGAPAVWSHGYTEASGVK 1185

  Fly   479 TYLLTAAPS-RNSVRSVDAVHSYAEIDINALGASRKSPILRPTLMSDELREEFKK 532
            ..|..||.| .|...:.:|::...:.|.|.     :.|.|....|||.|.||.:|
Human  1186 NKLCVAALSVNNFCDNREALYGVFDGDRNV-----EVPYLLQCTMSDILAEELQK 1235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 6/23 (26%)
CYCc 249..459 CDD:214485 45/229 (20%)
Nucleotidyl_cyc_III 298..484 CDD:299850 40/217 (18%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
PHLPP1NP_919431.2 leucine-rich repeat 1107..1129 CDD:275380 3/24 (13%)
PP2Cc 1168..1420 CDD:214625 19/73 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1458..1510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1673..1717
PDZ-binding, required for interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1715..1717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..470
PH_PHLPP-like 535..631 CDD:270131
PH 555..636 CDD:278594
LRR_RI 625..929 CDD:238064
LRR_8 638..703 CDD:290566
LRR 1 638..659
leucine-rich repeat 641..661 CDD:275380
LRR 2 661..682
leucine-rich repeat 662..692 CDD:275380
LRR 3 692..712
leucine-rich repeat 693..738 CDD:275380
LRR_8 714..770 CDD:290566
LRR 4 715..736
LRR 5 738..760
leucine-rich repeat 739..761 CDD:275380
LRR 6 761..783
leucine-rich repeat 762..784 CDD:275380
LRR 7 784..804
leucine-rich repeat 785..808 CDD:275380
LRR 8 808..831
leucine-rich repeat 810..832 CDD:275380
LRR_RI 814..1074 CDD:238064 24/129 (19%)
LRR 9 832..853
leucine-rich repeat 833..853 CDD:275380
leucine-rich repeat 854..895 CDD:275380
LRR 10 873..894
LRR 11 895..916
leucine-rich repeat 896..918 CDD:275380
LRR 12 918..939
leucine-rich repeat 919..941 CDD:275380
LRR 13 941..962
leucine-rich repeat 942..963 CDD:275380
LRR_8 962..1024 CDD:290566 14/72 (19%)
LRR 14 963..984 7/28 (25%)
leucine-rich repeat 964..987 CDD:275380 7/31 (23%)
LRR 15 987..1008 4/20 (20%)
leucine-rich repeat 988..1011 CDD:275380 3/22 (14%)
LRR 16 1013..1033 4/19 (21%)
LRR_8 1014..1072 CDD:290566 12/57 (21%)
leucine-rich repeat 1014..1037 CDD:275380 4/22 (18%)
LRR 17 1037..1058 5/20 (25%)
leucine-rich repeat 1038..1061 CDD:275380 6/22 (27%)
LRR 18 1061..1082 4/27 (15%)
Interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1076..1205 31/146 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.