DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gcy-36

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_510557.3 Gene:gcy-36 / 191657 WormBaseID:WBGene00001556 Length:675 Species:Caenorhabditis elegans


Alignment Length:349 Identity:88/349 - (25%)
Similarity:145/349 - (41%) Gaps:85/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 MLITCCATVAYLVIVFFQYSFIFEHSATTTPFMKAELAHCLRVCMML-------LTMYAKERQSE 801
            ||::....:.||...:          .|:.|.:   |.:.||:..|.       |.:..::|.|:
 Worm   340 MLMSSGGHIMYLCSPY----------VTSIPEL---LQYGLRLTAMPIHDPTRDLILLNQQRLSD 391

  Fly   802 FNTKINFKI-NQDLQGKQKAADITNKSIIILLTNILPSHVVEVYLDSVANHELYYENYKMVSVMF 865
            ....:..:. |:.|:...|..::.......||..:||..|.:.....::.....||.   .:|||
 Worm   392 VEMNLQLEANNEQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEE---ATVMF 453

  Fly   866 AMLINFQMDLP------SLRVLNDIITEFDRLLNAYKEYYVVEKIKVVGCTYMAACGLDFTLAKS 924
            ..:..||..:|      .:.:||::.|:||||:...|.|    |::.||.:||:..|:...:   
 Worm   454 TDVPTFQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAY----KVETVGDSYMSVGGIPDLV--- 511

  Fly   925 KFGSRTHASYSSELEQVLYRKESKGTENDHDEVAFIMTTFALDL-MRVLSVCNKAYAGRPFDRAL 988
                                       :||.||   :...||.: |...:||: .....|.    
 Worm   512 ---------------------------DDHCEV---ICHLALGMVMEARTVCD-PITNTPL---- 541

  Fly   989 STGEICIGISTGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPGHIHVTQETANILE-----Q 1048
               .|..||.:|.::||||||..|.|.::|:.||.:|||||....|.||.::......|     :
 Worm   542 ---HIRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMESHSPIGRIHCSENAKKCAESTGRFE 603

  Fly  1049 FDIMCMYRGMTFVKGRGEIPTYFV 1072
            |:    .||...:||:||:.|||:
 Worm   604 FE----PRGRVQIKGKGEMNTYFL 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 61/228 (27%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 66/230 (29%)
gcy-36NP_510557.3 HNOB 3..167 CDD:285002
HNOBA 217..435 CDD:285003 21/107 (20%)
CYCc 415..604 CDD:214485 62/236 (26%)
Guanylate_cyc 441..624 CDD:278633 67/235 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.