DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gcy-34

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_506319.1 Gene:gcy-34 / 191656 WormBaseID:WBGene00001554 Length:686 Species:Caenorhabditis elegans


Alignment Length:297 Identity:76/297 - (25%)
Similarity:127/297 - (42%) Gaps:70/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   791 LTMYAKERQSEFNTKINFKI---NQDLQGKQKAADITNKSIIILLTNILPSHVVEVYLDSVANHE 852
            |.:..::|.|:  .::|.::   |:.|:......::..:....:|.::||..:.:..|.......
 Worm   387 LILLNQQRLSD--VEVNLQLEANNEQLETMTHELEVERQKTDSILKDMLPRKIAKQLLSGEHLEP 449

  Fly   853 LYYENYKMVSVMFAMLINFQMDLP------SLRVLNDIITEFDRLLNAYKEYYVVEKIKVVGCTY 911
            ..||    .:|||..|..||..:|      .:::||::..:.||::.....|    |::.|..:|
 Worm   450 CEYE----ATVMFCDLPAFQQIIPVCQPKNIVKLLNEVFFKLDRIVVLRGVY----KVETVSDSY 506

  Fly   912 MAACGL-DFTLAKSKFGSRTHASYSSELEQVLYRKESKGTENDHDEVAFIMTTFALDLM----RV 971
            |...|: |:|                          |:..||        |...||.:|    .|
 Worm   507 MTVSGIPDYT--------------------------SEHAEN--------MCHVALGMMWEARSV 537

  Fly   972 LSVCNKAYAGRPFDRALSTGEICIGISTGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPGHI 1036
            :...||.    ||       .:.||:.:|.|:|||||...|.|.::|..|.:||:|||.|:.|.|
 Worm   538 MDPVNKT----PF-------LLRIGLHSGTIIAGVVGTKMPRYCLFGETVTLASQMESLGVAGKI 591

  Fly  1037 HVTQET-ANILEQFDIMCMYRGMTFVKGRGEIPTYFV 1072
            ..:..| :..:|........||...|||||::.|||:
 Worm   592 QCSSWTYSKAMETGRFEFSPRGRINVKGRGDVETYFL 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 59/233 (25%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 65/230 (28%)
gcy-34NP_506319.1 HNOB 3..167 CDD:285002
HNOBA 224..441 CDD:285003 9/55 (16%)
CYCc 421..609 CDD:214485 60/240 (25%)
Guanylate_cyc 453..629 CDD:278633 65/229 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.