DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gcy-27

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001255957.2 Gene:gcy-27 / 191654 WormBaseID:WBGene00001550 Length:616 Species:Caenorhabditis elegans


Alignment Length:319 Identity:79/319 - (24%)
Similarity:131/319 - (41%) Gaps:90/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 LAHCLRVCMMLLTMYAKERQSEFNTKINFKINQDLQGKQKAAD--------------ITNKSIII 830
            |.:.:.:|      ||       ::|.|. |:|.::..:|.||              :.....:.
 Worm   340 LRNAIAIC------YA-------DSKGNL-IDQMIRMNEKYADELETLVAARSADLALAQMQTMR 390

  Fly   831 LLTNILPSHVVEVYLDSVANHELYYENYKMVSVMFAMLINFQMDL---PSLRV---LNDIITEFD 889
            ||..:||:.:.:...:.|....   .:|...:|||..:.:|.:.|   |...|   ||||..:||
 Worm   391 LLNEMLPASIAKDLKNGVIAPA---RSYASATVMFVQICDFIVILKRRPPKEVIGFLNDIFDQFD 452

  Fly   890 RLLNAYKEYYVVEKIKVVGCTYMAACGLDFTLAKSKFGSRTHASYSSELEQVLYRKESKGTENDH 954
            .::..:..|    |::..|.|||.|.|:.                               .||:.
 Worm   453 TVIKRHDAY----KVETTGETYMVASGVP-------------------------------NENEG 482

  Fly   955 DEVAFIMTTFALDLMRVLSVC-----NKAYAGRPFDRALSTGEICIGISTGEIMAGVVGASQPHY 1014
            ..| |.:...:|:: |.:|:.     :|.|..|          :.||...|.|.|||:|...|.|
 Worm   483 RHV-FEVAEMSLEI-RAISLSYTLENDKNYKLR----------VRIGFHAGPIAAGVIGIKNPRY 535

  Fly  1015 DIWGNPVNMASRMESTGLPGHIHVTQETAN-ILEQFDIMCMYRGMTFVKGRGEIPTYFV 1072
            .::|:.||.||||:|...|..|..::.||. :|...:...:.||:..|||:||:..|::
 Worm   536 CLFGDTVNFASRMQSNCPPLQIQTSEITARMLLATHEYKLVKRGIVHVKGKGEVNCYWL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 59/233 (25%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 63/230 (27%)
gcy-27NP_001255957.2 PKc_like 75..338 CDD:304357
CYCc 383..573 CDD:214485 60/239 (25%)
Guanylate_cyc 411..595 CDD:278633 63/234 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.