DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gcy-6

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001294696.1 Gene:gcy-6 / 191644 WormBaseID:WBGene00001533 Length:1086 Species:Caenorhabditis elegans


Alignment Length:354 Identity:85/354 - (24%)
Similarity:161/354 - (45%) Gaps:63/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 MIYMF------LPIPSIRGAALLATSVSLMYIGLFIYFLK-SDDEDISEVVHDLDTICVDIFHYL 212
            :|||.      .|.||:.....:..:.:|:::....:..: |:..||.:|...|.::..:    .
 Worm   766 IIYMLKKGGLQSPRPSLEHDESIEINPALLHLVRDCWTERPSERPDIKQVASQLRSMNTN----R 826

  Fly   213 GFNLMGIFFRIMND--TMVRSSFLDRHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKE 275
            ..|||...|.::..  :.:.....:|.:.|.||      :::..:||..:||.|:|        :
 Worm   827 NDNLMDHVFNVLESYASTLEDEVAERMKELVEE------KKKSDVLLYRMLPRQVA--------D 877

  Fly   276 RIMLSETDSDRIVVNARRTENFMAIQIHPD----VSILYADVVNYTHLTTTLTVEKLVKVLHDLY 336
            ::.|.:|                   :.|:    |::.::|||::|.|....|..::|.:|:.||
 Worm   878 KLKLGQT-------------------VEPETFDIVTLFFSDVVSFTTLAGKCTPLQVVNLLNGLY 923

  Fly   337 GRFDMAASTFKVQRIKFLGDCYYCVAGLGEAD-PDHARMAVSLGISMIANIQEVRAHR--ALDID 398
            ..||.......|.:::.:||.|:..:|:...: .:|.|...|:.|:.:.::.:.....  ...|.
 Worm   924 TIFDGIIEQHDVYKVETIGDGYFVASGVPRRNGNEHTRNIASMSINFVKSLADFSIPHLPGEKIK 988

  Fly   399 MRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSL-NVAEYTVFPG 462
            :|:|.|.|:::|||:|....:|.::|..|:.|:|:|:..|||.:|:|......| .:..:|..|.
 Worm   989 IRVGFHCGSVVAGVVGLTMPRYCLFGDAVNTASRMESNSKPGQIHLSEEANQMLMRLGGFTTEPR 1053

  Fly   463 TEVAQSDPILQKQPMTTYLL-----TAAP 486
            .||.    |..|..|.||.|     :|||
 Worm  1054 GEVI----IKGKGVMATYWLLKMDESAAP 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 26/129 (20%)
CYCc 249..459 CDD:214485 52/217 (24%)
Nucleotidyl_cyc_III 298..484 CDD:299850 54/198 (27%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
gcy-6NP_001294696.1 PBP1_NPR_GC_like 29..445 CDD:107347
ANF_receptor 57..424 CDD:279440
PKc_like 585..822 CDD:304357 12/55 (22%)
HNOBA <847..879 CDD:285003 10/45 (22%)
CYCc 858..1048 CDD:214485 54/222 (24%)
Guanylate_cyc 885..1070 CDD:278633 53/188 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.