DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gcy-5

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_496219.1 Gene:gcy-5 / 191643 WormBaseID:WBGene00001532 Length:1122 Species:Caenorhabditis elegans


Alignment Length:336 Identity:81/336 - (24%)
Similarity:152/336 - (45%) Gaps:71/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 NLMGIFFRIMNDTMVRSSFLDRHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIML 279
            |||...|.::.: ...:..:|..:..||   |...:::..:||..:||.|:|        ||:..
 Worm   823 NLMDHVFNMLEE-YTSTLEVDIEERTKE---LTLEKKKADILLSRMLPKQVA--------ERLKA 875

  Fly   280 SETDSDRIVVNARRTENFMAIQIHPD----VSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFD 340
            .:|                   :.|:    |::|::|||.:|.|....:..::|.:|:|||..||
 Worm   876 GQT-------------------VEPEGFDTVTVLFSDVVKFTQLAAKCSPFQVVNLLNDLYSNFD 921

  Fly   341 MAASTFKVQRIKFLGDCYYCVAGL----GEADPDHARMAVSLGISMIANIQEVRA-HRALD-IDM 399
            .......|.:::.:||.|.||:||    |.|   |.:..|.:.:..:...:..:. |...: :::
 Worm   922 TIIEEHGVYKVESIGDGYLCVSGLPTKNGYA---HIKQIVDMSLKFMDYCKSFKVPHLPREKVEL 983

  Fly   400 RIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEY-----TV 459
            |||::||..:|||:|.:..:|.::|..|:.|:|:|:.|||..:|:| ....||....|     |.
 Worm   984 RIGINSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSMIHMS-EAAHSLLTDHYPHQYETS 1047

  Fly   460 FPGTEVAQSDPILQKQPMTTYLLTAAPSRNSVRSVDAVHSYAEIDINALGASRKSPILRPTLMSD 524
            ..|..:.:...:::    |.::|....|                |..:| ::|.:|.:.......
 Worm  1048 SRGEVIIKGKGVME----TFWVLGKTDS----------------DTKSL-STRTTPPITDENWPP 1091

  Fly   525 ELREEFKKMPV 535
            :::|:.||..|
 Worm  1092 QMKEDLKKRAV 1102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 14/60 (23%)
CYCc 249..459 CDD:214485 60/224 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 55/200 (28%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
gcy-5NP_496219.1 PBP1_NPR_GC_like 30..440 CDD:107347
ANF_receptor 49..426 CDD:279440
PK_GC 546..816 CDD:270894
HNOBA <830..873 CDD:285003 11/54 (20%)
CYCc 852..1042 CDD:214485 60/220 (27%)
Guanylate_cyc 879..1067 CDD:278633 54/195 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.