DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Npr3

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:286 Identity:52/286 - (18%)
Similarity:96/286 - (33%) Gaps:86/286 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 HPDVSILYADVV---------NYTHLTTTLTV-----EKLVKVL-HDLYGRFDMAASTFKVQRIK 352
            |.|:.:|.|..:         .|:|||.....     |.::.:. |..:.|..:..|..|::|  
Mouse   144 HWDLPMLSAGALAAGFQHKDTEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLER-- 206

  Fly   353 FLGDCYYCVAGLGEADPDHARMAVSLGISMIA-NIQEVRAHRALDIDMRIGVHSGTLLAGVIGQA 416
               :||:.:.|:.|...:.       |:...| |..|.   :.||:|                  
Mouse   207 ---NCYFTLEGVHEVFQEE-------GLHTSAYNFDET---KDLDLD------------------ 240

  Fly   417 KLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEVAQSDPILQKQPMTT-- 479
                       ||...::.:.:...:..||.|:..:.:|                :.:..||:  
Mouse   241 -----------DIVRYIQGSERVVIMCASGDTIRRIMLA----------------VHRHGMTSGD 278

  Fly   480 YLLTAAPSRNSVRSVDAVHSYAEIDINALGASRKSPILRPTLMSDELREEFKKMPVGGFNIRSPC 544
            |........||....|.  |:...|.:...|.:....|:...:...::.||:|.   ...::|..
Mouse   279 YAFFNIELFNSSSYGDG--SWRRGDKHDSEAKQAYSSLQTVTLLRTVKPEFEKF---SMEVKSSV 338

  Fly   545 CRDNSNDEKVNHGLGMFCVAFKDSSL 570
            .:...|:|..   :.||...|.|:.|
Mouse   339 EKQGLNEEDY---VNMFVEGFHDAIL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485 31/171 (18%)
Nucleotidyl_cyc_III 298..484 CDD:299850 34/198 (17%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 52/286 (18%)
ANF_receptor 66..419 CDD:279440 52/286 (18%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.