DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and daf-11

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_505960.3 Gene:daf-11 / 179605 WormBaseID:WBGene00000907 Length:1077 Species:Caenorhabditis elegans


Alignment Length:326 Identity:79/326 - (24%)
Similarity:134/326 - (41%) Gaps:89/326 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 MNDTMV-RSSFLDRHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRI 287
            :|:|:. |::.|::.|            ::...||..:||..:|..::..              |
 Worm   716 LNETVKNRTAELEKEQ------------EKGDQLLMELLPKSVANDLKNG--------------I 754

  Fly   288 VVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIK 352
            .|:.:..||         .:|||:|:|.:|.|.:.....::|.:|..:|.|||:..|.....:::
 Worm   755 AVDPKVYEN---------ATILYSDIVGFTSLCSQSQPMEVVTLLSGMYQRFDLIISQQGGYKME 810

  Fly   353 FLGDCYYCVAGLGEA-DPDHARMAVSLGISMIANIQ-------EVRAHRALDIDMRIGVHSGTLL 409
            .:||.|...|||... :.||.:     .|.|||.:|       |:.......::.|.|.:||.:.
 Worm   811 TIGDAYCVAAGLPVVMEKDHVK-----SICMIALLQRDCLHHFEIPHRPGTFLNCRWGFNSGPVF 870

  Fly   410 AGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFP--------GTEVA 466
            ||||||...:|..:|..|.:|:::|::|....:.:   ||:|..:.|.. ||        |..:.
 Worm   871 AGVIGQKAPRYACFGEAVILASKMESSGVEDRIQM---TLASQQLLEEN-FPQFVCSNRGGRTIE 931

  Fly   467 QSDPILQKQPMTTYLLTAAPSRNSVRSVDAVHSYAEIDINALGASRKSPILRPTLMSDELREEFK 531
            ....||      ||.|....:...|:.|:     .:.|:|                 |||....|
 Worm   932 GIGRIL------TYWLEGVNAGEQVKVVE-----FQNDLN-----------------DELSRIMK 968

  Fly   532 K 532
            |
 Worm   969 K 969

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 10/52 (19%)
CYCc 249..459 CDD:214485 57/217 (26%)
Nucleotidyl_cyc_III 298..484 CDD:299850 56/201 (28%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
daf-11NP_505960.3 Periplasmic_Binding_Protein_Type_1 <33..295 CDD:299141
PKc_like 447..695 CDD:304357
HNOBA <714..750 CDD:285003 10/45 (22%)
CYCc 729..922 CDD:214485 60/236 (25%)
Guanylate_cyc 756..943 CDD:278633 59/210 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.