DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and Gucy2e

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_036012232.1 Gene:Gucy2e / 14919 MGIID:105123 Length:1139 Species:Mus musculus


Alignment Length:302 Identity:88/302 - (29%)
Similarity:132/302 - (43%) Gaps:83/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 MMLLTMYA-------KERQSEFNTKINFKINQDLQGKQKAADITNKSIIILLTNILPSHVVEVYL 845
            :.:|..|:       :||..|..           |.|||    |::    |||.:||..|.|...
Mouse   855 LRMLEQYSSNLEDLIRERTEELE-----------QEKQK----TDR----LLTQMLPPSVAEALK 900

  Fly   846 DSVANHELYYENYKMVSVMFAMLINF----QMDLP--SLRVLNDIITEFDRLLNAYKEYYVVEKI 904
            ...:....|:|.   |::.|:.::.|    .|..|  .:.:|||:.|.||.::.|:..|    |:
Mouse   901 MGTSVEPEYFEE---VTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVY----KV 958

  Fly   905 KVVGCTYMAACGLDFTLAKSKFGSRTHASYSSELEQVLYRKESKGTENDHDEVAFIMTTFALDLM 969
            :.:|..||.|.||     ..:.|.| ||:                      |:|    ..:||::
Mouse   959 ETIGDAYMVASGL-----PQRNGQR-HAA----------------------EIA----NMSLDIL 991

  Fly   970 RVLSVCNKAYAGRPFDRALSTGEICIGISTGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPG 1034
            ..:......:......|      |.||:.:|..:|||||.:.|.|.::|:.||.||||||||||.
Mouse   992 SAVGSFRMRHMPEVPVR------IRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY 1050

  Fly  1035 HIHVTQETANIL----EQFDIMCMYRGMTFVKGRGEIPTYFV 1072
            .|||...|..||    :.|.:.|  ||.|.:||:|...||::
Mouse  1051 RIHVNMSTVRILRALDQGFQMEC--RGRTELKGKGIEDTYWL 1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 68/231 (29%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 71/228 (31%)
Gucy2eXP_036012232.1 PBP1_sensory_GC_DEF-like 58..465 CDD:380594
PK_GC-2D 570..845 CDD:270945
HNOBA <854..899 CDD:400168 17/62 (27%)
CYCc 879..1070 CDD:214485 72/243 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.