DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gc2

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_021333059.1 Gene:gc2 / 140425 ZFINID:ZDB-GENE-011128-8 Length:1120 Species:Danio rerio


Alignment Length:320 Identity:72/320 - (22%)
Similarity:142/320 - (44%) Gaps:66/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 DTMVRSSFLDRHQFLKEEMWLRQ-------ARQQESMLLDSILPPQIAKPIQQSIKERIMLSETD 283
            |:|:|  .|:::....||: :|:       .:|:...||..:|||.:|        |.:.|..| 
Zfish   822 DSMLR--MLEQYSSNLEEL-IRERTEELEIEKQKTEKLLTQMLPPSVA--------EALKLGTT- 874

  Fly   284 SDRIVVNARRTENFMAIQIHPD----VSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAAS 344
                              :.|:    ||:.::|:|.:|.::......::|.:|:|||..||....
Zfish   875 ------------------VEPEHFESVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTTFDAVIG 921

  Fly   345 TFKVQRIKFLGDCYYCVAGLGEADPD-HARMAVSLGISMIANIQEVRAHRALDID--MRIGVHSG 406
            ...|.:::.:||.|...:|:...:.: ||....::.:.:::.:...|.....|:.  :|||:|:|
Zfish   922 NHDVYKVETIGDAYMVASGVPVPNGNRHAAEIANMALDILSAVGTFRMRHMPDVPVRIRIGLHTG 986

  Fly   407 TLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSL---------NVAEYTVFPG 462
            ..:|||:|....:|.::|..|..|:|:|:||.|..:||...|:..|         .:...|...|
Zfish   987 PCVAGVVGLTMPRYCLFGDTVTTASRMESTGLPYRIHVHSSTVKILMELKLGYRVELRARTELKG 1051

  Fly   463 TEVAQS------DPILQKQPMTTYLLTAAPSRN-------SVRSVDAVHSYAEIDINALG 509
            ..:.::      |...:..|:...|.:...|::       :||.:..|...|::.::..|
Zfish  1052 KRIEETYWLTGRDGFTKPLPVPPVLKSGLESKDFKVMLKKAVRKISTVRQVAQLTLSDEG 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 14/56 (25%)
CYCc 249..459 CDD:214485 54/225 (24%)
Nucleotidyl_cyc_III 298..484 CDD:299850 49/207 (24%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
gc2XP_021333059.1 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..815 CDD:270945
HNOBA <824..869 CDD:311573 14/55 (25%)
CYCc 848..1040 CDD:214485 54/218 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.