DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gucy2f

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:343 Identity:77/343 - (22%)
Similarity:155/343 - (45%) Gaps:86/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 FRIMN--------DTMVRSSFLDRHQFLKEEM------WLRQARQQESMLLDSILPPQIAKPIQQ 271
            |:::|        |:|:|  .|:::....|::      .|...:|:...||..:|||.:|:    
Zfish   810 FKLINKGKKTNIIDSMLR--MLEQYSSNLEDLIRERTEELEVEKQRTEKLLSEMLPPSVAE---- 868

  Fly   272 SIKERIMLSETDSDRIVVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLY 336
                               |.:|...:..:....|:|.::|:|.:|.:::.....::|.:|:|||
Zfish   869 -------------------ALKTGASVEPEYFDQVTIYFSDIVGFTTISSLSDPIEVVDLLNDLY 914

  Fly   337 GRFDMAASTFKVQRIKFLGDCYYCVAGLGEADPD-HARMAVSLGISMIANIQ--EVRAHRALDID 398
            ..||....:..|.:::.:||.|...:||.:.:.: ||....::.:::::::.  ::|....:.:.
Zfish   915 SLFDAVLGSHDVYKVETIGDAYMVASGLPKKNGNKHAAEIANMSLNILSSVGSFKMRHMPEVPVR 979

  Fly   399 MRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRT---LSSLN------V 454
            :|||:|||..:|||:|....:|.::|..|:.|:|:|:||.|..:||:..|   |.|||      |
Zfish   980 IRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNISTVQILRSLNDGYKIDV 1044

  Fly   455 AEYTVFPGTEVAQSDPILQKQPMTTYLLTAAPSRNSVRSVDAVHSYAEIDINALGASRKSPILRP 519
            ...|...|..:.::..::.|...|      .|..|                        .|.::|
Zfish  1045 RGKTELKGKGIEETYWLVGKANFT------KPLPN------------------------PPEIKP 1079

  Fly   520 -----TLMSDELREEFKK 532
                 .:|::|::..|:|
Zfish  1080 GDNWQDMMTEEIKSLFRK 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 15/68 (22%)
CYCc 249..459 CDD:214485 57/221 (26%)
Nucleotidyl_cyc_III 298..484 CDD:299850 52/197 (26%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945 2/5 (40%)
HNOBA <825..870 CDD:311573 12/69 (17%)
CYCc 850..1042 CDD:214485 56/214 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.