DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gucy1b1

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:423 Identity:100/423 - (23%)
Similarity:177/423 - (41%) Gaps:117/423 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LVDIFQILVFH--FKYHWPLNTLYDVFVLCMIYMFLPIPSIRGA-ALLATSVSLMYI-GLFIYFL 187
            |:.:|.::..|  ..:|..|:.:..||||......|.:...... .|..|.:|.:.: |..||..
 Frog   250 LLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLP 314

  Fly   188 KSDD------------ED-------ISEV-VHDLDTICVDIFHYLGFNLMGIFFR---------- 222
            ::|:            :|       :|:: :||.....|         |:|..||          
 Frog   315 EADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLV---------LLGEQFREEYKLTQELE 370

  Fly   223 IMNDTMVRSSFLDRH--QFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSD 285
            |:.|.:       :|  :.|::|      :::...||.|:|||.:|..::.              
 Frog   371 ILTDRL-------QHTLRALEDE------KKKTDTLLYSVLPPSVANELRH-------------- 408

  Fly   286 RIVVNARRTENFMAIQIHPDVSILYADVVNY-THLTTTLTVE---KLVKVLHDLYGRFDMAASTF 346
            :..|.|:|.:|         |:||::.:|.: |..:...:.|   |:|.:|:|:|.|||:...:.
 Frog   409 KRPVPAKRYDN---------VTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSR 464

  Fly   347 K---VQRIKFLGDCYYCVAGLGEADPDHARMAVSLGISMIANIQEVRAHRALD---IDMRIGVHS 405
            .   |.:::.:||.|..|:|:.|....|||....|.:.|:    |:.....:|   :.:.||:|:
 Frog   465 NNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMM----EIAGQVQVDGESVQITIGIHT 525

  Fly   406 GTLLAGVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEVAQSDP 470
            |.::.|||||...:|.::|..|::.:|.|.||:.|          .:||:|||.........|||
 Frog   526 GEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG----------KINVSEYTYRCLMSPENSDP 580

  Fly   471 ILQKQ------------PMTTYLLTAAPSRNSV 491
            ....|            ||..:.|:...:...|
 Frog   581 QFHLQYRGPVSMKGKTDPMQVWFLSRKAAETEV 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 38/184 (21%)
CYCc 249..459 CDD:214485 60/219 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 57/207 (28%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 38/177 (21%)
Guanylate_cyc 412..605 CDD:306677 60/215 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.