DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gucy1a2

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:281 Identity:75/281 - (26%)
Similarity:133/281 - (47%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 HQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENFMAIQ 301
            ||.|:||      :::...||.||.|..:|:.:.|.:.              |.|::.:      
Zfish   355 HQALEEE------KRRTVDLLYSIFPGDVAQRLWQGLP--------------VQAKKFD------ 393

  Fly   302 IHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVAGLGE 366
               ||::|::|:|.:|.:....|..:::.:|::||.|||.......|.:|:.:||.|....||..
Zfish   394 ---DVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHR 455

  Fly   367 ADPDHARMAVSLGISMIANIQEVRAHRALDIDMRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIAN 431
            ....||:....:.:.|:...:||.......|.:|||:|||::||||:|....:|.::|.:|.:|:
Zfish   456 KIDSHAKPIALMALKMMELSEEVLTPDGKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLAS 520

  Fly   432 RLEATGKPGYVHVSGRTLSSL-NVAEYTVFPGTEVAQSDPILQKQPMTTYLLTAAPSRNSVRSVD 495
            :.|:...|..::||..|...| :...:|..|.:.....|...::.|...|.|.|..|:       
Zfish   521 KFESGSHPRCINVSPTTYQLLRDDRSFTFIPRSRQELPDNFPKEIPGICYFLEAGKSQ------- 578

  Fly   496 AVHSYAEIDINALGASRKSPI 516
               |:|     :|.::|.:||
Zfish   579 ---SHA-----SLTSTRSAPI 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 12/38 (32%)
CYCc 249..459 CDD:214485 56/210 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 53/186 (28%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.