DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and gucy1a2

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001120379.1 Gene:gucy1a2 / 100145454 XenbaseID:XB-GENE-1011801 Length:712 Species:Xenopus tropicalis


Alignment Length:264 Identity:73/264 - (27%)
Similarity:125/264 - (47%) Gaps:37/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 HQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENFMAIQ 301
            ||.|:||      :::...||.||.|..:|:.:.:...              |.||:.:      
 Frog   460 HQALEEE------KKKTVDLLYSIFPGDVAQQLWEGKS--------------VQARKFD------ 498

  Fly   302 IHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVAGLGE 366
               ||::|::|:|.:|.:....|..:::.:|::||.|||.......:.:::.:||.|...|||..
 Frog   499 ---DVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGFLDIYKVETIGDAYCVAAGLLR 560

  Fly   367 ADPDHARMAVSLGISMIANIQEVRAHRALDIDMRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIAN 431
            ....||:....:.:.|:...:||.......|.||||:|||::||||:|....:|.::|.:|.:|:
 Frog   561 QSNSHAKPIALMALKMMELSEEVLTPDGRPIKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLAS 625

  Fly   432 RLEATGKPGYVHVSGRTLSSL-NVAEYTVFPGTEVAQSDPILQKQPMTTYLLTA-------APSR 488
            :.|:...|..::||..|...| :.|.:...|.:.....|...::.|...|.|.|       .||.
 Frog   626 KFESGSHPRRINVSPTTYQLLKDEANFHFVPRSREELPDNFPKEIPGICYFLEADSGQKQPKPSL 690

  Fly   489 NSVR 492
            .|||
 Frog   691 TSVR 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 11/38 (29%)
CYCc 249..459 CDD:214485 57/210 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 53/186 (28%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
gucy1a2NP_001120379.1 Pap_E4 30..>86 CDD:367150
HNOB <132..248 CDD:377902
HNOBA 296..486 CDD:369471 11/31 (35%)
Guanylate_cyc 492..679 CDD:306677 56/195 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.