| Sequence 1: | NP_652601.3 | Gene: | ACXE / 53426 | FlyBaseID: | FBgn0040506 | Length: | 1123 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598582.3 | Gene: | Phlpp1 / 98432 | MGIID: | 2138327 | Length: | 1687 | Species: | Mus musculus |
| Alignment Length: | 326 | Identity: | 60/326 - (18%) |
|---|---|---|---|
| Similarity: | 121/326 - (37%) | Gaps: | 88/326 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 837 HI--VDVYLNSLAKHELYFENYRMVSVMFAMLINFEMDLRSLRVLNEIIAEFDTLLLFYKEYYTV 899
Fly 900 EKIKIVGCTYMAACGLDLN--FAGS-------------------TSTNRKESIPPTEFNEEQSRR 943
Fly 944 ILFQQSNEDLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGA 1008
Fly 1009 SQPHYDIWGNPVNM-------------ASRMESTGLPGHIHVTEETSEILQQFGIT--C-SYRGM 1057
Fly 1058 TFVKGRGKIPTYLVGIDENLNFIPQKATRFPSHQE-----------RSTVISLQSTYTHAENNNS 1111
Fly 1112 I 1112 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ACXE | NP_652601.3 | AC_N | <31..272 | CDD:318454 | |
| Nucleotidyl_cyc_III | 290..459 | CDD:325147 | |||
| Nucleotidyl_cyc_III | 851..1071 | CDD:325147 | 45/256 (18%) | ||
| Phlpp1 | NP_598582.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..96 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 230..406 | ||||
| PH_PHLPP-like | 491..587 | CDD:270131 | |||
| PH | 511..592 | CDD:278594 | |||
| LRR_RI | 581..885 | CDD:238064 | 29/149 (19%) | ||
| LRR_8 | 594..659 | CDD:290566 | |||
| LRR 1 | 594..615 | ||||
| leucine-rich repeat | 597..617 | CDD:275380 | |||
| LRR 2 | 617..638 | ||||
| leucine-rich repeat | 618..648 | CDD:275380 | |||
| LRR_8 | 647..726 | CDD:290566 | |||
| LRR 3 | 648..669 | ||||
| LRR 4 | 671..692 | ||||
| leucine-rich repeat | 672..694 | CDD:275380 | |||
| LRR 5 | 694..715 | ||||
| leucine-rich repeat | 695..717 | CDD:275380 | |||
| LRR 6 | 717..739 | ||||
| leucine-rich repeat | 718..740 | CDD:275380 | |||
| LRR 7 | 740..760 | ||||
| leucine-rich repeat | 741..764 | CDD:275380 | 60/326 (18%) | ||
| LRR 8 | 764..785 | 9/33 (27%) | |||
| LRR_RI | 768..1030 | CDD:238064 | 54/299 (18%) | ||
| leucine-rich repeat | 768..788 | CDD:275380 | 8/32 (25%) | ||
| LRR 9 | 788..809 | 2/20 (10%) | |||
| leucine-rich repeat | 789..809 | CDD:275380 | 2/19 (11%) | ||
| leucine-rich repeat | 810..851 | CDD:275380 | 8/43 (19%) | ||
| LRR 10 | 829..850 | 3/20 (15%) | |||
| LRR 11 | 851..872 | 5/23 (22%) | |||
| leucine-rich repeat | 852..874 | CDD:275380 | 6/24 (25%) | ||
| LRR 12 | 874..895 | 3/30 (10%) | |||
| leucine-rich repeat | 875..897 | CDD:275380 | 3/31 (10%) | ||
| LRR_8 | 896..954 | CDD:290566 | 10/63 (16%) | ||
| LRR 13 | 897..918 | 2/20 (10%) | |||
| leucine-rich repeat | 898..919 | CDD:275380 | 2/20 (10%) | ||
| LRR 14 | 919..940 | 7/26 (27%) | |||
| leucine-rich repeat | 920..943 | CDD:275380 | 6/28 (21%) | ||
| LRR 15 | 943..964 | 4/23 (17%) | |||
| leucine-rich repeat | 944..967 | CDD:275380 | 6/25 (24%) | ||
| LRR 16 | 969..989 | 5/19 (26%) | |||
| LRR_8 | 970..1028 | CDD:290566 | 8/57 (14%) | ||
| leucine-rich repeat | 970..993 | CDD:275380 | 5/22 (23%) | ||
| LRR 17 | 993..1014 | 2/20 (10%) | |||
| leucine-rich repeat | 994..1017 | CDD:275380 | 2/22 (9%) | ||
| LRR 18 | 1017..1038 | 2/20 (10%) | |||
| LRR 19 | 1040..1061 | 3/12 (25%) | |||
| LRR 20 | 1062..1083 | ||||
| leucine-rich repeat | 1063..1085 | CDD:275380 | |||
| LRR 21 | 1085..1106 | ||||
| PP2Cc | 1124..1376 | CDD:214625 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1414..1465 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1604..1687 | ||||
| PDZ-binding | 1685..1687 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||