DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Gucy2g

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:290 Identity:71/290 - (24%)
Similarity:126/290 - (43%) Gaps:73/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   793 VKERQIEFTNKVNFNWRVDLRKEENAASLTNHSIIIILNNILPSHIVDVYLNSLAKHELYFENYR 857
            |:||..|..        .:.||.|.           :|:.:|||.:.:   ..:|...:..|::.
Mouse   856 VEERTRELV--------AEKRKVEK-----------LLSTMLPSFVGE---QLIAGKSVEPEHFE 898

  Fly   858 MVSVMFAMLINF------EMDLRSLRVLNEIIAEFDTLLLFYKEYYTVEKIKIVGCTYMAACGLD 916
            .|::.|:.::.|      ...|:.:::||::.:.||..:    :.:.|.|::.:|..||.|.||.
Mouse   899 SVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTI----QSHDVYKVETIGDAYMVASGLP 959

  Fly   917 LNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNEDLDEVVFVMTSYALDMMRTLAKSNEAYQSI 981
            :                             :...:..||:. .|..:.|.:.......:...:.:
Mouse   960 I-----------------------------RNGAQHADEIA-TMALHLLSVTTHFQIGHMPEERL 994

  Fly   982 AGDRNITDGTIAIGISSGEVMAGIVGASQPHYDIWGNPVNMASRMESTGLPGHIHVTEETS-EIL 1045
                     .:.||:.:|.|:||:||.:.|.|.::|:.|||||||||:.||..|||::.|: .:|
Mouse   995 ---------KLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTAGALL 1050

  Fly  1046 QQFGITCSYRGMTFVKGRGKIPTY-LVGID 1074
            ...|.....||...|||:|:..|: |.|.|
Mouse  1051 AAGGYHLQKRGTISVKGKGEQTTFWLKGKD 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 56/227 (25%)
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894
CYCc 865..1055 CDD:214485 56/246 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.