DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Gucy1a1

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001343916.1 Gene:Gucy1a1 / 60596 MGIID:1926562 Length:691 Species:Mus musculus


Alignment Length:278 Identity:78/278 - (28%)
Similarity:136/278 - (48%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VIFIAQGFAQFASALFSVGGMSVDIV-----HYLCLNLVGIFYRVMNDTVVRSSFLDRHQYIKEK 239
            :|:|.:     :||:..:|...||.:     ..|.|:.:.| :..:.|.|:..........:|::
Mouse   370 MIYIVE-----SSAILFLGSPCVDRLEDFTGRGLYLSDIPI-HNALRDVVLIGEQARAQDGLKKR 428

  Fly   240 IWLRNARL--------QEKQ----LLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAI 292
            :....|.|        :||:    ||.||.|.:::   |:..||:||.||:              
Mouse   429 LGKLKATLEHAHQALEEEKKRTVDLLCSIFPSEVA---QQL
WQGQIVQAKK-------------- 476

  Fly   293 QIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLS 357
              ..:|::|::|:|.:|.:.:..:...::.:|:.||.|||.......|.:::.:||.|....||.
Mouse   477 --FSEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLH 539

  Fly   358 DPDPDHANNCVILGLSMINHIMEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLDVTIA 422
            .....||....::.|.|:....||...||..|.||||:|||::||||:|....::.::|.:||:|
Mouse   540 RESDTHAVQIALMALKMMELSNEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLA 604

  Fly   423 NVLESTGVPGCVHISGAT 440
            |..||..||..:::|..|
Mouse   605 NKFESCSVPRKINVSPTT 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 24/108 (22%)
Nucleotidyl_cyc_III 290..459 CDD:325147 49/151 (32%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
Gucy1a1NP_001343916.1 HNOBA 277..466 CDD:311573 23/104 (22%)
Guanylate_cyc 472..643 CDD:306677 52/167 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.