DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and npr1b

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:XP_009290669.2 Gene:npr1b / 555911 ZFINID:ZDB-GENE-100805-4 Length:1070 Species:Danio rerio


Alignment Length:275 Identity:76/275 - (27%)
Similarity:132/275 - (48%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 RSSFLDR-----HQY---IKEKIWLR-NARLQEKQ----LLDSILPPQISLPLQKDIQGRIVMAK 277
            ||:.||.     .||   ::|.:..| .|.|:||:    ||..|||..::..|           |
Zfish   820 RSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQL-----------K 873

  Fly   278 QGIHSWTAMERTMAIQIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQR 342
            :|        .|:..:....|:|.::|:|.:|.|:...|...:|.:|:|||..||.....:.|.:
Zfish   874 RG--------ETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYK 930

  Fly   343 IKFLGDCYYCVAGLSDPDPD-HANNCVILGLSMINHIMEVRDIHGLD--INMRIGVHSGNLFAGV 404
            ::.:||.|..|:||...:.. |......:.|:::..:...:..|..|  :.:|||:|||.:.|||
Zfish   931 VETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGV 995

  Fly   405 IGEAKLQFDIWGLDVTIANVLESTGVPGCVHISGATLNNL-DVNRFDIE-DGPEEARDHPLLKKY 467
            :|....::.::|..|..::.:||.|.|..:|:|.||...| :.|.|.:| .|..|.:.     |.
Zfish   996 VGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKG-----KG 1055

  Fly   468 RIRSYIIRQDLHMDD 482
            ::|:|.:..::...|
Zfish  1056 KMRTYWLLGEVKAGD 1070

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 18/58 (31%)
Nucleotidyl_cyc_III 290..459 CDD:325147 51/173 (29%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
npr1bXP_009290669.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.