DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gucy1a1

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001296458.1 Gene:gucy1a1 / 550420 ZFINID:ZDB-GENE-050417-230 Length:679 Species:Danio rerio


Alignment Length:293 Identity:81/293 - (27%)
Similarity:135/293 - (46%) Gaps:47/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VIFIAQGFAQFASALFSVGGMSVDIVHYLC---LNLVGI-FYRVMNDTVVRSSFLDRHQYIKEKI 240
            :||:::     .|||..:|...||.:..|.   |.|..| .:..:.|.|:..........:|:::
Zfish   374 MIFMSE-----MSALLFLGSPCVDKLEELTGRGLYLSDIPIHNALRDVVLVGEQTKAQDGLKKRL 433

  Fly   241 WLRNARLQEK------------QLLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAIQ 293
            ....|.|::.            :||.:|.|..::   |:..||..|.||:..|            
Zfish   434 GKAKAALEQAHQALEEEKRRTVELLFTIFPGNVA---QRLWQGLPVQAKKFDH------------ 483

  Fly   294 IHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLSD 358
                |::|::|:|.:|.:.:..|...:|.:|.:||.|||.......|.:::.:||.|....||..
Zfish   484 ----VTVLFSDIVGFTAICSRCTPMQVVNMLSELYTRFDHHCGELDVYKVETIGDAYCVAGGLHK 544

  Fly   359 PDPDHANNCVILGLSMINHIMEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLDVTIAN 423
            ..|.||....::.|.|:....||....|..|.||||:|||::.|||:|....::.::|.:||:||
Zfish   545 ESPTHAVQIALMALKMMELSDEVTTPMGEVIRMRIGIHSGSVLAGVVGVKMPRYCLFGNNVTLAN 609

  Fly   424 VLESTGVPGCVHISGATLNNLDVNRFDIEDGPE 456
            ..||..:|..:::|..|...|       :|.||
Zfish   610 KFESCSLPRKINVSPTTYRLL-------KDCPE 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 23/107 (21%)
Nucleotidyl_cyc_III 290..459 CDD:325147 53/167 (32%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
gucy1a1NP_001296458.1 HNOBA 279..470 CDD:285003 22/103 (21%)
CYCc 449..635 CDD:214485 62/211 (29%)
Guanylate_cyc 476..647 CDD:278633 57/183 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.