DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and NPR2

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:277 Identity:74/277 - (26%)
Similarity:130/277 - (46%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 FYRVMN----DTVVRSSFLDRHQY-------IKEKIWLRNARLQEKQ----LLDSILPPQISLPL 265
            |.|..|    .:::.:..|...||       ::|:   ..|.|:||:    ||..|||..::..|
Human   841 FIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEER---TQAYLEEKRKAEALLYQILPHSVAEQL 902

  Fly   266 QKDIQGRIVMAKQGIHSWTAMERTMAIQIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGR 330
                       |:|        .|:..:....|:|.::|:|.:|.|:...|...:|.:|:|||..
Human   903 -----------KRG--------ETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTC 948

  Fly   331 FDLAAYRYKVQRIKFLGDCYYCVAGLSDPDPD-HANNCVILGLSMINHIMEVRDIHGL--DINMR 392
            ||.....:.|.:::.:||.|..|:||...:.. ||.....:.|::::.:...|..|..  .:.:|
Human   949 FDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLR 1013

  Fly   393 IGVHSGNLFAGVIGEAKLQFDIWGLDVTIANVLESTGVPGCVHISGATLNNLD-VNRFDIE-DGP 455
            ||||:|.:.|||:|....::.::|..|..|:.:||.|....:|:|..|.:.|| :..|.:| .|.
Human  1014 IGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGD 1078

  Fly   456 EEARDHPLLKKYRIRSY 472
            .|.:.     |.::|:|
Human  1079 VEMKG-----KGKMRTY 1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 17/70 (24%)
Nucleotidyl_cyc_III 290..459 CDD:325147 51/173 (29%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944 3/6 (50%)
HNOBA <857..902 CDD:311573 13/47 (28%)
CYCc 881..1065 CDD:214485 56/202 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.