DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Gyc89Db

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:298 Identity:72/298 - (24%)
Similarity:127/298 - (42%) Gaps:80/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 CITFLIMFVKERQ----IEFTNKVNFNWRVDLRKEENAASLTNHSIIIILNNILPSHIVDVYLNS 845
            |....|||.||.|    :|.:.::..:|:   |:.:.           :|.:::|..|.:....|
  Fly   432 CSKLEIMFEKEEQRSDELEKSLELADSWK---RQGDE-----------LLYSMIPRPIAERMRKS 482

  Fly   846 LAKHELYFENYRMVSVMFAMLI--------NFEMDLRSLRVLNEIIAEFDTLLLFYKEYYTVEKI 902
               .|...:::..|||:|..::        |.:..::::..||::.:..|..::....|    |:
  Fly   483 ---EEHVCQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY----KV 540

  Fly   903 KIVGCTYMAACGL-DLNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNEDLDEVVFVMTSYALD 966
            :.||..|||..|. |:|              |                         :...:|.|
  Fly   541 ETVGMVYMAVSGAPDVN--------------P-------------------------LHAEHACD 566

  Fly   967 MMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHYDIWGNPVNMASRMESTGL 1031
            :...:.|..:|:.       :....|.:||:||.|:||:||...|.|.::|:.||.||||||:..
  Fly   567 LALRVMKKVKAHA-------LPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSD 624

  Fly  1032 PGHIHVTEETSEILQQFGITCSYRGMTFVKGRGKIPTY 1069
            |..|.::..|:..:|:.|.....||...|||:|::.||
  Fly   625 PWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETY 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 57/228 (25%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 13/60 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 57/225 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453994
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.