DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Gyc88E

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster


Alignment Length:328 Identity:85/328 - (25%)
Similarity:149/328 - (45%) Gaps:55/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 MIYM--FLPIHFISGAV---LLALLVSGLYILYFVIFIAQGFAQFASALFSVGGMSVDIVHYLCL 210
            |:||  :..|.|:...|   |.:|:.:||||                ...|:...|.|::     
  Fly   307 MVYMENWRMIMFLGTPVMPDLTSLITTGLYI----------------NDLSMHDFSRDLM----- 350

  Fly   211 NLVGIFYRVMNDTVVRSSFLDRHQYIKEKIWLRNARLQEK-----QLLDSILPPQISLPLQKDIQ 270
             |.|     ...:|.....||:.|...:|:......|.|:     :||..::|.|::        
  Fly   351 -LAG-----TQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVA-------- 401

  Fly   271 GRIVMAKQGIHSWTAMERTMAIQIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAA 335
            .|:...:..|.:         .::...||||::|:|.:|.:.:.:|...:|.:|:.:|..||...
  Fly   402 DRLRRGENPIDT---------CEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLT 457

  Fly   336 YRYKVQRIKFLGDCYYCVAGLSDPDPDHANNCVILGLSMINHIMEVRD-IHGLDINMRIGVHSGN 399
            .|..|.:::.:||.|..|||..|.|.:||.....:.|.|::.|.:::| ..|..:.:|:|||||.
  Fly   458 ERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGA 522

  Fly   400 LFAGVIGEAKLQFDIWGLDVTIANVLESTGVPGCVHISGATLNNLDVNRFDIEDGPEEARDHPLL 464
            :.||::|....::.::|..|..|:.:|||.:...||||.:|...:..|...||.|..:.:....:
  Fly   523 VVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTM 587

  Fly   465 KKY 467
            ..|
  Fly   588 GTY 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 28/130 (22%)
Nucleotidyl_cyc_III 290..459 CDD:325147 54/169 (32%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 28/131 (21%)
CYCc 383..571 CDD:214485 57/204 (28%)
Herpes_ICP4_C 794..>955 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453996
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.