DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and GUCY2D

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_000171.1 Gene:GUCY2D / 3000 HGNCID:4689 Length:1103 Species:Homo sapiens


Alignment Length:270 Identity:70/270 - (25%)
Similarity:113/270 - (41%) Gaps:55/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 LRKEENAASLTNHSIIIILNNILPSHIVDVYLNSLAKHELYFENYRMVSVMFAMLINF------E 870
            :|:......|.......:|..:||..:.:...........|||   .|::.|:.::.|      .
Human   835 IRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFE---QVTLYFSDIVGFTTISAMS 896

  Fly   871 MDLRSLRVLNEIIAEFDTLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAGSTSTNRKESIPPTE 935
            ..:..:.:||::...||.::..:..|    |::.:|..||.|.||.                   
Human   897 EPIEVVDLLNDLYTLFDAIIGSHDVY----KVETIGDAYMVASGLP------------------- 938

  Fly   936 FNEEQSRRILFQQSNEDLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGE 1000
              :...:|...:.:|..||    ::::.....||.:.:              ....|.||:.||.
Human   939 --QRNGQRHAAEIANMSLD----ILSAVGTFRMRHMPE--------------VPVRIRIGLHSGP 983

  Fly  1001 VMAGIVGASQPHYDIWGNPVNMASRMESTGLPGHIHVTEETSEILQQF--GITCSYRGMTFVKGR 1063
            .:||:||.:.|.|.::|:.||.||||||||||..|||...|..||:..  |.....||.|.:||:
Human   984 CVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGK 1048

  Fly  1064 GKIPTY-LVG 1072
            |...|: |||
Human  1049 GAEDTFWLVG 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 62/228 (27%)
GUCY2DNP_000171.1 PBP1_sensory_GC_DEF-like 55..431 CDD:380594
PK_GC-2D 536..811 CDD:270945
HNOBA <820..865 CDD:369471 5/29 (17%)
CYCc 846..1036 CDD:214485 58/235 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1065..1103
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.