DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and GUCY1B1

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:275 Identity:75/275 - (27%)
Similarity:117/275 - (42%) Gaps:71/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   811 DLRKEENAASLTNHSIIII-LNNILPSHIVDVYLNSLA-KHELYFENYRMVSVMFAMLINF---- 869
            |.|..:...|::....::| ||.:|.|.:.....|.|. |..:..:.|..|:::|:.::.|    
Human   413 DSRSTKGFPSISYSGFLLIPLNRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFC 477

  Fly   870 ------EMDLRSLRVLNEIIAEFDTLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAGSTSTNRK 928
                  |..::.:.:||::...||||....|..: |.|::.||..||...||             
Human   478 SKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPF-VYKVETVGDKYMTVSGL------------- 528

  Fly   929 ESIPPTEFNEEQSRRILFQQSNEDLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDG--- 990
               |....:..:|                  :...|||||           .|||...: ||   
Human   529 ---PEPCIHHARS------------------ICHLALDMM-----------EIAGQVQV-DGESV 560

  Fly   991 TIAIGISSGEVMAGIVGASQPHYDIWGNPVNMASRMESTGLPGHIHVTEETSEILQ-------QF 1048
            .|.|||.:|||:.|::|...|.|.::||.||:.||.|:||..|.|:|:|.|...|.       ||
Human   561 QITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQF 625

  Fly  1049 GITCSYRGMTFVKGR 1063
            .:  .:||...:||:
Human   626 HL--EHRGPVSMKGK 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 64/233 (27%)
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 9/35 (26%)
Guanylate_cyc 455..648 CDD:306677 64/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.