DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and GUCY1A2

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:384 Identity:87/384 - (22%)
Similarity:143/384 - (37%) Gaps:143/384 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LDR-HQYIKEKIWLRNARLQEKQLLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAIQ 293
            |:| ||.::|:      :.:...||.||.|..::   |:..||:.|.|::               
Human   476 LERTHQALEEE------KKKTVDLLYSIFPGDVA---QQLWQGQQVQARK--------------- 516

  Fly   294 IHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLSD 358
             ..||::|::|:|.:|.:....|...::.:|::||.|||.......:.:::.:||.|...|||..
Human   517 -FDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHR 580

  Fly   359 PDPDHANNCVILGLSMINHIMEVRDIHGLDI-------------------------------NMR 392
            ....||....::.|.|:....||....|..|                               .||
Human   581 KSLCHAKPIALMALKMMELSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSETDLGTEKMR 645

  Fly   393 IGVHSGNLFAGVIGEAKLQFDIWGLDVTIANVLESTGVPGCVHISGATLNNLDVNRFDIEDGPEE 457
            ||:|||::.|||:|....::.::|.:||:|:..||...|..:::|..|                 
Human   646 IGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTT----------------- 693

  Fly   458 ARDHPLLKKYRIRSYIIRQDLHMDDEDSDEFLGDLHSISLCNMGAQPRISDSANQSLRALFHEEL 522
               :.|||:                |:|..|:              ||            ..|||
Human   694 ---YQLLKR----------------EESFTFI--------------PR------------SREEL 713

  Fly   523 REEFRKMPVSAFSPKRLLGICRF---NTGKEVPAHQNLNICLTFTDPILERAYLKQTDY 578
            .:.|         ||.:.|||.|   .||.:.|            .|.|..:.:|:..|
Human   714 PDNF---------PKEIPGICYFLEVRTGPKPP------------KPSLSSSRIKKVSY 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 12/42 (29%)
Nucleotidyl_cyc_III 290..459 CDD:325147 47/199 (24%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003 10/32 (31%)
CYCc 485..705 CDD:214485 63/280 (23%)
Guanylate_cyc 514..729 CDD:278633 66/301 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.