DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Gucy2g

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_620611.2 Gene:Gucy2g / 245708 RGDID:621853 Length:1103 Species:Rattus norvegicus


Alignment Length:270 Identity:67/270 - (24%)
Similarity:122/270 - (45%) Gaps:56/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   815 EENAASLT--NHSIIIILNNILPSHIVDVYLNSLAKHELYFENYRMVSVMFAMLINF------EM 871
            ||....|.  ...:..:|:.:|||.:.:   ..:|...:..|::..|::.|:.::.|      ..
  Rat   860 EERTCQLVAEKRKVEKLLSTMLPSFVGE---QLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSS 921

  Fly   872 DLRSLRVLNEIIAEFDTLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAGSTSTNRKESIPPTEF 936
            .|:.:::||::.:.||..:    :.:.|.|::.:|..||.|.||.:                   
  Rat   922 PLQVVKLLNDLYSLFDHTI----QTHDVYKVETIGDAYMVASGLPI------------------- 963

  Fly   937 NEEQSRRILFQQSNEDLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEV 1001
                      :...:..||:. .|:.:.|.:.......:...:.:         .:.||:.:|.|
  Rat   964 ----------RNGAQHADEIA-TMSLHLLSVTTNFQIGHMPEERL---------KLRIGLHTGPV 1008

  Fly  1002 MAGIVGASQPHYDIWGNPVNMASRMESTGLPGHIHVTEETSE-ILQQFGITCSYRGMTFVKGRGK 1065
            :||:||.:.|.|.::|:.|||||||||:.||..|||::.|:. :|...|.....||...|||:|:
  Rat  1009 VAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTARALLVAGGYHLQKRGTISVKGKGE 1073

  Fly  1066 IPTY-LVGID 1074
            ..|: |.|.|
  Rat  1074 QTTFWLTGKD 1083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 56/227 (25%)
Gucy2gNP_620611.2 PBP1_GC_G_like 50..439 CDD:107367
ANF_receptor 66..417 CDD:279440
PK_GC 558..832 CDD:270894
CYCc 868..1058 CDD:214485 53/235 (23%)
Guanylate_cyc 895..1081 CDD:278633 57/228 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.