DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-37

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_500171.2 Gene:gcy-37 / 191658 WormBaseID:WBGene00001557 Length:708 Species:Caenorhabditis elegans


Alignment Length:292 Identity:57/292 - (19%)
Similarity:125/292 - (42%) Gaps:45/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 QEKQLLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAIQIHPDVSILYADVVNYTHLT 312
            |..:||...:||.|:..|:                   ..:|:..|...|.|:::.|:.::..::
 Worm   402 QTDRLLFEFVPPVIAEALR-------------------AAKTVPAQEFSDCSVIFTDIPDFFTIS 447

  Fly   313 TTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLSDPDPDHANNCVILGLSMINH 377
            ...:...::.|:.||:.|||....::|..::..|.|.|..|.|:.:.:..|..:.:.|.|.::..
 Worm   448 VNCSPTEIITVVTDLFHRFDRIIEKHKGYKVLSLMDSYLIVGGVPNANQYHCEDSLNLALGLLFE 512

  Fly   378 IMEVRDIHGLD--INMRIGVHSGNLFAGVIGEAKLQFDIWGLDVTIANVLESTGVPGCVHISGAT 440
            ..:| .:..|:  :.:|||||.|.:.||::.:.|.:|.:.|..|.:...:.|...||.|.:|.|.
 Worm   513 AKQV-VVPKLERSVRLRIGVHCGPVVAGIVSQQKPRFCVLGNTVNVTKSICSHSSPGKVLVSNAV 576

  Fly   441 LNNLDVNRFDIEDGPEEARDHPLLKKYRIRSYIIRQDLHMDDEDS---DEFLGDLHSISLCNMGA 502
                                ..::.|:....::...:.:::.:..   ..||......|:.::..
 Worm   577 --------------------RTMVTKHLKSIFVFNANGYLELQSGKVLTHFLEKNEKCSVWDIVD 621

  Fly   503 QPRISDSANQSLRALFHEELREEFRKMPVSAF 534
            :.:.::.:....|.|..:...||:::..|:|:
 Worm   622 RDKATNDSIDGYRELHSDNGTEEWQEATVAAY 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 7/23 (30%)
Nucleotidyl_cyc_III 290..459 CDD:325147 39/170 (23%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
gcy-37NP_500171.2 HNOB 3..165 CDD:285002
HNOBA 223..419 CDD:285003 6/16 (38%)
CYCc 400..577 CDD:214485 47/214 (22%)
Nucleotidyl_cyc_III 425..609 CDD:299850 41/204 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.