DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-23

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_500309.3 Gene:gcy-23 / 191652 WormBaseID:WBGene00001548 Length:1073 Species:Caenorhabditis elegans


Alignment Length:256 Identity:70/256 - (27%)
Similarity:114/256 - (44%) Gaps:61/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   829 ILNNILPSHIVDVYLNSLAK-HELYFENYRMVSVMFAMLINF------EMDLRSLRVLNEIIAEF 886
            :|..:||.::.    |.|.. ..:..:.:.|.:|||:.::.|      ...|..:.:||.|.::|
 Worm   850 LLGQLLPKYVA----NELKMGRSVPAKTFDMATVMFSDIVGFTTICSSSTPLEVVSMLNSIYSKF 910

  Fly   887 DTLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNE 951
            |..:..:..|    |::.:|..||...|:                 |.|...|..|.|       
 Worm   911 DDAINKHGSY----KVETIGDAYMIVSGI-----------------PEENGNEHIRNI------- 947

  Fly   952 DLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHYDIW 1016
                     .:.||::|..|    :.|: |...||: ...|.:||.:|.|.||:||.:.|.|.::
 Worm   948 ---------CNTALELMLLL----KTYE-IPHRRNV-KLRIRLGIHTGTVAAGVVGLTAPRYCLF 997

  Fly  1017 GNPVNMASRMESTGLPGHIHVTEETSEI----LQQFGITCSYRGMTFVKGRGKIPTY-LVG 1072
            |:.||:|||||||..|..|.:::|..:.    ..:|.||  .||....||:|.:.:| |:|
 Worm   998 GDTVNVASRMESTSEPEKIQMSQEARDFCVRYYSEFQIT--LRGTVEAKGKGPVTSYWLLG 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 63/230 (27%)
gcy-23NP_500309.3 Periplasmic_Binding_Protein_Type_1 38..407 CDD:299141
ANF_receptor 38..385 CDD:279440
PK_GC 509..806 CDD:270894
HNOBA <817..863 CDD:285003 4/16 (25%)
CYCc 842..1035 CDD:214485 60/231 (26%)
Guanylate_cyc 869..1056 CDD:278633 64/231 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.