DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-21

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001364740.1 Gene:gcy-21 / 191651 WormBaseID:WBGene00001546 Length:1163 Species:Caenorhabditis elegans


Alignment Length:291 Identity:81/291 - (27%)
Similarity:125/291 - (42%) Gaps:71/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   829 ILNNILPSHIVD-VYLNSLAKHELYFENYRMVSVMFAMLINF-EMDLRS-----LRVLNEIIAEF 886
            :|..:||..:.| :.|.|....| .|||   .:|.|:....| ||...|     ::.||::...|
 Worm   925 LLKMMLPEVVADSLKLGSNVSAE-SFEN---CTVFFSDCPGFVEMSATSKPIDIVQFLNDLYTVF 985

  Fly   887 DTLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNE 951
            |.::    :.:.|.|::.:...||.|.||              .:|               ..|.
 Worm   986 DRII----DQFDVYKVETIADAYMVASGL--------------PVP---------------NGNH 1017

  Fly   952 DLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDGTI--AIGISSGEVMAGIVGASQPHYD 1014
            ...|:    .|..|    .|.|:.|:::.    |::.:..:  .||::||..:||:||...|.|.
 Worm  1018 HAGEI----ASLGL----ALLKAVESFKI----RHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYC 1070

  Fly  1015 IWGNPVNMASRMESTGLPGHIHVTEETSEILQQF-GITCSYRGMTFVKGRGKIPTYLVGIDENLN 1078
            ::|:.||.||||||.|:|..|:.:....|||.|. |.....||:..:||:||..||.|. .||.:
 Worm  1071 LFGDTVNTASRMESNGIPLRINCSGTAKEILDQLGGYEIEERGIVEMKGKGKQMTYFVR-GENSD 1134

  Fly  1079 FIPQKATRFPSHQERSTVISL------QSTY 1103
            ...::..|     ||....||      :.||
 Worm  1135 MRRERIIR-----ERVKFASLKKAQIQEKTY 1160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 64/228 (28%)
gcy-21NP_001364740.1 Periplasmic_Binding_Protein_type1 58..422 CDD:415822
PK_GC 612..881 CDD:270894
HNOBA <890..938 CDD:400168 4/12 (33%)
Guanylate_cyc 944..1130 CDD:306677 66/235 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.