DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-17

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001293327.1 Gene:gcy-17 / 191649 WormBaseID:WBGene00001542 Length:1088 Species:Caenorhabditis elegans


Alignment Length:287 Identity:77/287 - (26%)
Similarity:135/287 - (47%) Gaps:60/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 GFAQFASALFSVGGMSVD--IVHYL--C----------LNLVGIFYRVMNDTVVRSSFLDRHQY- 235
            ||.....:|.:...:.::  :||.:  |          ::.|....|.|||. .:.:.:| |.: 
 Worm   762 GFNAIRPSLLTDEALEINPALVHLIRDCWTEKPSERPPIDQVRSLLRGMNDG-KKGNLMD-HVFN 824

  Fly   236 --------IKEKIWLRNARLQEKQ-----LLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAME 287
                    ::|::..|...|.|:|     ||..:||..::..|           |.|        
 Worm   825 MLETYASTLEEEVNERTKELVEEQKKSDVLLYRMLPKTVAEKL-----------KAG-------- 870

  Fly   288 RTMAIQIHPD----VSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGD 348
                |.|.|:    |:|.::|||.:|.|.:..|...:|::|:|||..||....:..|.:::.:||
 Worm   871 ----ISIEPETFELVTIFFSDVVQFTTLASKCTPLQVVQLLNDLYTIFDSIIEQNDVYKVETIGD 931

  Fly   349 CYYCVAGLSDPD-PDHANNCVILGLSMINHIMEVRDIH--GLDINMRIGVHSGNLFAGVIGEAKL 410
            .|.||:||...: .||..:...:.|:.::.:.|.|..|  ...||:|||::.|::.|||:|....
 Worm   932 GYLCVSGLPHRNGHDHIKHIARMSLAFLSSLAEFRVAHMPSERINLRIGINCGSVVAGVVGLTMP 996

  Fly   411 QFDIWGLDVTIANVLESTGVPGCVHIS 437
            ::.::|..|..|:.:||.|.||.:|:|
 Worm   997 RYCLFGDAVNTASRMESNGKPGRIHVS 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 23/113 (20%)
Nucleotidyl_cyc_III 290..459 CDD:325147 52/155 (34%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
gcy-17NP_001293327.1 Periplasmic_Binding_Protein_Type_1 25..404 CDD:299141
ANF_receptor 47..398 CDD:279440
PKc_like 539..808 CDD:304357 7/45 (16%)
Pkinase 567..803 CDD:278497 6/40 (15%)
HNOBA <824..867 CDD:285003 9/42 (21%)
CYCc 846..1038 CDD:214485 61/201 (30%)
Guanylate_cyc 873..1060 CDD:278633 51/151 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.