DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-15

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001364713.1 Gene:gcy-15 / 191648 WormBaseID:WBGene00001541 Length:1104 Species:Caenorhabditis elegans


Alignment Length:321 Identity:87/321 - (27%)
Similarity:137/321 - (42%) Gaps:75/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 EFTNKVNFNWRVDLRKEENAASLTNHSIIIILNNILPSHIVD-VYLNSLAKHELYFENYRMVSVM 862
            ::|:|:..:  :..|.||..|......  .:|..:||..:.| :.|.|....| .|||   .:|.
 Worm   840 KYTDKLEKD--IAERNEELEAEKAKSE--ALLKMMLPEVVADSLKLGSNVSAE-SFEN---CTVF 896

  Fly   863 FAMLINF-EMDLRS-----LRVLNEIIAEFDTLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAG 921
            |:....| ||...|     ::.||::...||.::    :.:.|.|::.:...||.|.||      
 Worm   897 FSDCPGFVEMSATSKPIDIVQFLNDLYTVFDRII----DQFDVYKVETIADAYMVASGL------ 951

  Fly   922 STSTNRKESIPPTEFNEEQSRRILFQQSNEDLDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRN 986
                    .:|               ..|....|:    .|..|    .|.|:.|:::.    |:
 Worm   952 --------PVP---------------NGNHHAGEI----ASLGL----ALLKAVESFKI----RH 981

  Fly   987 ITDGTI--AIGISSGEVMAGIVGASQPHYDIWGNPVNMASRMESTGLPGHIHVTEETSEILQQF- 1048
            :.:..:  .||::||..:||:||...|.|.::|:.||.||||||.|:|..|:.:....|||.|. 
 Worm   982 LPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQLG 1046

  Fly  1049 GITCSYRGMTFVKGRGKIPTYLVGIDENLNFIPQKATRFPSHQERSTVISL------QSTY 1103
            |.....||:..:||:||..||.|. .||.:...::..|     ||....||      :.||
 Worm  1047 GYEIEERGIVEMKGKGKQMTYFVR-GENSDMRRERIIR-----ERVKFASLKKAQIQEKTY 1101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 64/228 (28%)
gcy-15NP_001364713.1 Periplasmic_Binding_Protein_type1 2..363 CDD:415822
PK_GC 553..822 CDD:270894
HNOBA <831..879 CDD:400168 10/42 (24%)
Guanylate_cyc 885..1071 CDD:306677 66/235 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.