DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-14

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_506660.2 Gene:gcy-14 / 191647 WormBaseID:WBGene00001540 Length:1111 Species:Caenorhabditis elegans


Alignment Length:315 Identity:78/315 - (24%)
Similarity:131/315 - (41%) Gaps:77/315 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   828 IILNNILPSHIVD-VYLNSLAKHELYFENYRMVSVMFAMLINFE------MDLRSLRVLNEIIAE 885
            ::|..:||..:.| :.|....:.    |.:..|::.|:.::.|.      ..|:.:.:||::...
 Worm   846 VLLYRMLPKMVADKLKLGQTVEP----ETFEQVTIFFSDVVQFTTLAGKCTPLQVVTLLNDLYTI 906

  Fly   886 FDTLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSN 950
            ||.::    |...|.|::.:|..|:...||.                             .:..|
 Worm   907 FDGII----EQNDVYKVETIGDGYLCVSGLP-----------------------------HRNGN 938

  Fly   951 EDLDEVVFVMTSY--ALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHY 1013
            |.:..:..:...:  :|:..|.        |.:..:|.    .:.|||:.|.|:||:||.:.|.|
 Worm   939 EHIRHIARMSLGFLSSLEFFRV--------QHLPSERI----NLRIGINCGSVVAGVVGLTMPRY 991

  Fly  1014 DIWGNPVNMASRMESTGLPGHIHVTEETSEILQQF--GITCSYRGMTFVKGRGKIPTY-LVGIDE 1075
            .::|:.||.||||||.|.||.||||.|.:::|.|.  |.....||...:||:|.:.|| |:|...
 Worm   992 CLFGDAVNTASRMESNGKPGKIHVTAEANQMLTQVVGGFRTESRGEVIIKGKGVMETYWLLGEQS 1056

  Fly  1076 NLNF---IPQKATRFPSHQERSTVIS-------------LQSTYTHAENNNSIAS 1114
            .::.   .|::.|..|..::....||             |.|.|....|.|...|
 Worm  1057 RISVSAQAPREKTPEPPRRQSVRSISPIIEKMSEETQKGLYSAYKDFNNGNECVS 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 60/230 (26%)
gcy-14NP_506660.2 PBP1_NPR_GC_like 21..423 CDD:107347
ANF_receptor 43..418 CDD:279440
PKc_like 535..800 CDD:304357
HNOBA <817..860 CDD:285003 4/13 (31%)
CYCc 839..1031 CDD:214485 58/233 (25%)
Guanylate_cyc 866..1053 CDD:278633 61/235 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.