DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-13

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_506097.3 Gene:gcy-13 / 191646 WormBaseID:WBGene00001539 Length:1028 Species:Caenorhabditis elegans


Alignment Length:256 Identity:65/256 - (25%)
Similarity:121/256 - (47%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SVDIVHYLCLNLVGIFYRVMN----------DTVVRSSFLDRH-QYIKEKIWLRNARLQEKQ--- 251
            ::|:|:.|..|        ||          |.|.  |.|::| ..:::::..|...|.|::   
 Worm   759 NIDMVNKLMKN--------MNSGRSGSANLMDHVF--SVLEKHASSLEDEVQERMKELVEEKKKS 813

  Fly   252 --LLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAIQIHPDVSILYADVVNYTHLTTT 314
              ||..:||.|::..|:                   :.:::..:....|:|.::|||.:|.|...
 Worm   814 DILLYRMLPQQVAERLK-------------------LGQSVEPEAFESVTIFFSDVVGFTVLANK 859

  Fly   315 LTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLSDPD-PDHANNCVILGLSMINHI 378
            .|...:|.:|:|||..||....:....:::.:||.|..|:||...: .:|..|...:.|.:::.:
 Worm   860 STPLQVVNLLNDLYTTFDAIIEKNDSYKVETIGDAYLVVSGLPRRNGTEHVANIANMSLELMDSL 924

  Fly   379 MEVRDIH--GLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLDVTIANVLESTGVPGCVHIS 437
            ...:..|  ...:.:|||:|||:..|||:|....::.::|..|..|:.:||.|.||.:|:|
 Worm   925 QAFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLS 985

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 20/86 (23%)
Nucleotidyl_cyc_III 290..459 CDD:325147 45/151 (30%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
gcy-13NP_506097.3 PBP1_NPR_GC_like 3..397 CDD:107347
ANF_receptor 13..368 CDD:279440
PKc_like 548..770 CDD:304357 4/18 (22%)
HNOBA <797..829 CDD:285003 8/31 (26%)
CYCc 808..1000 CDD:214485 52/197 (26%)
Guanylate_cyc 835..1022 CDD:278633 45/151 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.