DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-11

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001359843.1 Gene:gcy-11 / 181745 WormBaseID:WBGene00001537 Length:1168 Species:Caenorhabditis elegans


Alignment Length:301 Identity:79/301 - (26%)
Similarity:136/301 - (45%) Gaps:58/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 SFLDRHQ-----YIKEKI-WLRNARLQEKQLLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAM 286
            :.|||::     .|||:. .|.:.|.:.:.||..:||..::..|:   .|:.|.|          
 Worm   901 NLLDRYRNNLEDVIKERTEQLEDERKRNESLLLQLLPKSVANSLK---NGQPVDA---------- 952

  Fly   287 ERTMAIQIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYY 351
                  :.:..|||.::|:|.:|.|::..|...:|.:|::||..||....::...:::.:||.|.
 Worm   953 ------EFYDSVSIYFSDIVGFTALSSKSTPLQVVNMLNNLYTNFDTIIDKFDCYKVETIGDAYM 1011

  Fly   352 CVAGLSDPDPD---HANNCVILGLSMINHIMEVRDIHGLD--INMRIGVHSGNLFAGVIGEAKLQ 411
            .|:||  |:.:   ||.......|.:::.|......|..|  :.:|||.|:|.:..||:|....:
 Worm  1012 FVSGL--PEVNSYLHAGEVASASLELLDSIKTFTVSHCPDEKLRLRIGNHTGPVVTGVVGIRMPR 1074

  Fly   412 FDIWGLDVTIANVLESTGVPGCVHISGATLNNLDVNRFDIEDG--PEEARDHPLLK-KYRIRSYI 473
            :.::|..|.|||::||:|.|..:.||.      |.....::.|  ..|.|:..:|| |..:.:| 
 Worm  1075 YCLFGDTVIIANMMESSGEPMRIQISS------DAYELILKCGGYVTEQREKIVLKNKLEVMTY- 1132

  Fly   474 IRQDLHMDDEDSDEFLGDL-----------HSISLCNMGAQ 503
                 .|:|...|..|..|           |.|...|.|.:
 Worm  1133 -----WMNDYSKDARLARLVAHQEKFPHLEHLIHKFNKGVR 1168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 13/49 (27%)
Nucleotidyl_cyc_III 290..459 CDD:325147 49/175 (28%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
gcy-11NP_001359843.1 Periplasmic_Binding_Protein_type1 <234..452 CDD:385651
PKc_like 640..890 CDD:389743
CYCc 923..1116 CDD:214485 57/219 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.