DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Npr3

DIOPT Version :10

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:79 Identity:18/79 - (22%)
Similarity:33/79 - (41%) Gaps:20/79 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 HPDVSILYADVV---------NYTHLTTTLTV-----EMLVKVL-HDLYGRFDLAAYRYKVQRIK 344
            |.|:.:|.|..:         .|:|||.....     ||::.:. |..:.|..|.....|::|  
Mouse   144 HWDLPMLSAGALAAGFQHKDTEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLER-- 206

  Fly   345 FLGDCYYCVAGLSD 358
               :||:.:.|:.:
Mouse   207 ---NCYFTLEGVHE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AcyC 65..453 CDD:441717 18/79 (23%)
Nucleotidyl_cyc_III 290..459 CDD:448371 18/79 (23%)
Nucleotidyl_cyc_III 851..1071 CDD:448371
Npr3NP_032754.2 PBP1_NPR_C 46..441 CDD:380609 18/79 (23%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.