DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Npr3

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:79 Identity:18/79 - (22%)
Similarity:33/79 - (41%) Gaps:20/79 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 HPDVSILYADVV---------NYTHLTTTLTV-----EMLVKVL-HDLYGRFDLAAYRYKVQRIK 344
            |.|:.:|.|..:         .|:|||.....     ||::.:. |..:.|..|.....|::|  
Mouse   144 HWDLPMLSAGALAAGFQHKDTEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLER-- 206

  Fly   345 FLGDCYYCVAGLSD 358
               :||:.:.|:.:
Mouse   207 ---NCYFTLEGVHE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147 18/79 (23%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 18/79 (23%)
ANF_receptor 66..419 CDD:279440 18/79 (23%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.