DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-33

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_001256392.1 Gene:gcy-33 / 179644 WormBaseID:WBGene00001553 Length:947 Species:Caenorhabditis elegans


Alignment Length:372 Identity:80/372 - (21%)
Similarity:150/372 - (40%) Gaps:92/372 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   716 PWVTTNMLSLMICLTFTFAHIPIMVKTAVAILETLAYLLLIFFQFDFVFHHSVTTNPYFKSEYAH 780
            |:||......::..:.||      :..|..:::||          |.:|...:..|.:.:|:   
 Worm   318 PYVTLRGPITVLKSSETF------LLLATCVVDTL----------DTMFKMGLYLNDFGESD--- 363

  Fly   781 ALLICITFLIMFVKERQIEFTNKVNFNWR-----VDLRKEENAASLTNHSIIIILNNILPSHIVD 840
                |...:||...::.......:....|     .::.:|.:.|..|..:   :|..::|..:..
 Worm   364 ----CNREIIMATIQKSDTLKTMLENEKRRSEVLTEMTREISEAKKTART---LLTQMMPYEVAQ 421

  Fly   841 VYLNSLAKHELYFENYRMVSVMFAMLINFEM------DLRSLRVLNEIIAEFDTLLLFYKEYYTV 899
            ..:.|.:..  :.|.:..||:.|..:.:|..      ....:.:||.|.:..|:::    :.:.|
 Worm   422 TMMRSGSVD--HCEAFECVSIGFIRVCDFSKISLFIEAFEVVNLLNTIYSHLDSIV----DTHGV 480

  Fly   900 EKIKIVGCTYMAACGLDLNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNEDLD-EVVFVMTSY 963
            .|::.:|.:||.:.|...                                .:|.| |:|   :..
 Worm   481 YKVETIGESYMISAGCPY--------------------------------RDDYDAEMV---SDC 510

  Fly   964 ALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHYDIWGNPVNMASRMES 1028
            .|:|:..: ||.| |||....:.:   .|..||.:|.|:.|:||...|.|.::|:.||.||||||
 Worm   511 CLEMVSHI-KSFE-YQSHDAVKKV---LIKCGIFTGPVVGGVVGVRTPRYCLFGDTVNTASRMES 570

  Fly  1029 TG-LPGHIHVTEETSEILQQ-----FGITCSYRGMTFVKGRGKIPTY 1069
            :. .|..|.:.:.|.:.:::     |.|  ..:|..||||:|.:..|
 Worm   571 SNQTPMTIQIGQRTKDRVEKQASGAFRI--KPKGNVFVKGKGDMRVY 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 58/232 (25%)
gcy-33NP_001256392.1 HNOB 2..164 CDD:377902
HNOBA 204..423 CDD:369471 21/130 (16%)
CYCc 402..598 CDD:214485 55/244 (23%)
COG5134 <595..744 CDD:227463 9/23 (39%)
TDA11 <710..>898 CDD:293689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.