DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gcy-18

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:NP_502449.2 Gene:gcy-18 / 178237 WormBaseID:WBGene00001543 Length:1113 Species:Caenorhabditis elegans


Alignment Length:264 Identity:65/264 - (24%)
Similarity:122/264 - (46%) Gaps:59/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 RVMNDTVVRS--SFLDR-----HQYIK--EKI------WLRNARLQEKQLLDSILPPQISLPLQK 267
            |:..:.|:::  |.:|:     .||..  ||:      .|..|.::..|||..:||..::..|: 
 Worm   841 RLNTEMVLKTKGSLVDQMMKMMEQYANNLEKLVAERTGMLEEANIRADQLLTQLLPAYVANELK- 904

  Fly   268 DIQGRIVMAKQGIHSWTAMERTMAIQIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFD 332
                              |.|::|.:::...:||::|:|.:|.:.:..|...:|.:|:.||..||
 Worm   905 ------------------MGRSVAPKLYSSATILFSDIVGFTTICSGSTPLEVVNMLNGLYTGFD 951

  Fly   333 LAAYRYKVQRIKFLGDCYYCVAGLSDPDP-DHANNCVILGLSMINHI----MEVRDIHGLDINMR 392
            ....|.|..:::.:||.|..|:|:.:.:. :|:.|.....|.|..::    :..|..|  .:..|
 Worm   952 ECITRNKSYKVETIGDAYMVVSGIPEENEYNHSRNIANTALDMRQYLTGYQIPHRPTH--RVRCR 1014

  Fly   393 IGVHSGNLFAGVIGEAKLQFDIWGLDVTIANVLESTGVPGCVHISGATLNNLDVNRFDIEDGPEE 457
            .|.|:|::.|||:|....::.::|..|.:::.:||||.||.:.:|                  ||
 Worm  1015 WGFHTGSVAAGVVGLTCPRYCLFGDTVNVSSRMESTGTPGMIQMS------------------EE 1061

  Fly   458 ARDH 461
            |..|
 Worm  1062 AHMH 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 16/68 (24%)
Nucleotidyl_cyc_III 290..459 CDD:325147 45/173 (26%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
gcy-18NP_502449.2 Periplasmic_Binding_Protein_Type_1 87..448 CDD:299141
ANF_receptor 87..395 CDD:279440
PKc_like 549..846 CDD:304357 1/4 (25%)
HNOBA <857..903 CDD:285003 11/45 (24%)
CYCc 882..1073 CDD:214485 56/223 (25%)
Guanylate_cyc 909..1095 CDD:278633 47/177 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.